BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K18 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02620.1 68416.m00253 acyl-[acyl-carrier-protein] desaturase,... 29 3.9 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 29 3.9 At3g57420.1 68416.m06393 expressed protein contains Pfam domain ... 28 6.8 >At3g02620.1 68416.m00253 acyl-[acyl-carrier-protein] desaturase, putative / stearoyl-ACP desaturase, putative similar to Acyl-[acyl-carrier protein] desaturase from Spinacia oleracea SP|P28645, Olea europaea SP|Q43593; contains Pfam profile PF03405 Fatty acid desaturase Length = 396 Score = 28.7 bits (61), Expect = 3.9 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 3/98 (3%) Frame = +1 Query: 130 PNHVSKSITISASWSIENNINHYKNETAVKIWILMKKQNWLLPLSVPF-SPLNPTHQFEA 306 P H+ S T + N + H T K+ I +NW + + P+ + Q + Sbjct: 36 PRHLQVSKTFRPIKEVSNQVTH--TITQEKLEIFKSMENWAQENLLSYLKPVETSWQPQ- 92 Query: 307 VIMFNVLYSAKDYDTFYKTTVYMKDRVNQ--DLYIYVL 414 + L KD D FY+ ++DR + D Y VL Sbjct: 93 ----DFLPETKDEDRFYEQVKELRDRTKEIPDDYFVVL 126 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +1 Query: 568 TYKWDNSVVIRSNTT----VWHYHCQSASMSYYLPDYSLNAH 681 T WD ++V+ +N VW C+ +M+ + P + L AH Sbjct: 175 TVMWDGTMVVAANDRGTCYVWRSLCERQTMTEFEPLHKLQAH 216 >At3g57420.1 68416.m06393 expressed protein contains Pfam domain PF03385: Protein of unknown function, DUF288 Length = 765 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 343 YDTFYKTTVYMKDRVNQDLYIYVLSTLHIHR 435 Y +KT V + R N DLY+ HI++ Sbjct: 534 YGRIFKTVVILSSRKNSDLYVQEAKLDHIYK 564 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,981,233 Number of Sequences: 28952 Number of extensions: 315360 Number of successful extensions: 734 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -