BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K16 (491 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 28 0.88 SPAC1486.03c |||RNA-binding splicing factor|Schizosaccharomyces ... 27 1.5 SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 26 3.5 SPBC16D10.10 |||tRNA specific adenosine deaminase subunit Tad2 |... 25 4.7 SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces po... 25 6.2 SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pomb... 25 6.2 SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 25 6.2 SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr... 25 8.2 SPAC10F6.05c |ubc6||ubiquitin conjugating enzyme Ubc6|Schizosacc... 25 8.2 SPCC1795.02c ||SPCC895.01|CaCA proton/calcium exchanger|Schizosa... 25 8.2 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 25 8.2 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 27.9 bits (59), Expect = 0.88 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +2 Query: 197 NDKRLDMLEIDSFVYKLDTGKNNIVRSSLEMHGVIEQRPWTKNILEKGFDTTGTGFKSIE 376 N K L+ + + SFV K+N +++S E+ +IE+ + KN++ F G KS E Sbjct: 754 NYKSLESIGLTSFV------KDNKLKASKELQKLIEENVFPKNLILFIFRKCVIGIKSFE 807 >SPAC1486.03c |||RNA-binding splicing factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 797 Score = 27.1 bits (57), Expect = 1.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 320 KNILEKGFDTTGTGFKSIESWWYKSRLG 403 KNI + F+TTG G K +E YK G Sbjct: 106 KNIPKMKFNTTGFGAKMLEKMGYKQGQG 133 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 25.8 bits (54), Expect = 3.5 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 135 TQSFVYLLVPNTIAWAAS*ASMTNALTCSKSIASSINSTL 254 TQS Y +T+ W+ S T+ S+ +++ NST+ Sbjct: 3866 TQSVYYNATSSTVPWSNSTFRNTSNTMTSRFVSNDFNSTI 3905 >SPBC16D10.10 |||tRNA specific adenosine deaminase subunit Tad2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 25.4 bits (53), Expect = 4.7 Identities = 12/52 (23%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = -2 Query: 328 YVFSPRSLFDNAVHLERAADDVVLTSVEFIDEAIDF--EHVKAFVIDAHEAA 179 +V + +D+++H R D++L E ID A+ F +H++ + + ++ + Sbjct: 152 FVTLSKPAYDSSIHPTRENADIILPQKENIDTALLFVSQHLQDILAEMNKTS 203 >SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 25.0 bits (52), Expect = 6.2 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 72 CGVLITSLSRCLSMLCQIRLLTQSFVYLLVPNTIAWAA 185 CG++ SL +RLL + VY IAWA+ Sbjct: 203 CGLIANSLFN--DTFSSLRLLDDNSVYTFSTKNIAWAS 238 >SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pombe|chr 3|||Manual Length = 1647 Score = 25.0 bits (52), Expect = 6.2 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 193 AHEAAHAIVFGTNKYTNDCVNSLI*HNIDRHLERL 89 A E +A G NKY N+ V SLI N H L Sbjct: 1147 ATEIHYAASVGQNKYLNEYVASLIRTNEKTHSTEL 1181 >SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 862 Score = 25.0 bits (52), Expect = 6.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 382 PTLDALETCSSCVETFFQYVFSPRSLFDNAVHLER 278 P+LD ETCS+ V FSP ++ N + R Sbjct: 27 PSLDYFETCSNFVPRAGIPTFSPYAVIKNFDEVNR 61 >SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr 3|||Manual Length = 1516 Score = 24.6 bits (51), Expect = 8.2 Identities = 32/100 (32%), Positives = 42/100 (42%), Gaps = 8/100 (8%) Frame = +3 Query: 48 LIWSTLRVCGVLITSLSRCLSMLCQIRLLTQSFV---YLLVPNTIAWAAS*ASMTNALTC 218 ++ S LR CGVL T C R FV Y+LVP+ + T +LT Sbjct: 680 MVVSQLRACGVLETIKISCAGF--PSRWTFDEFVSRYYMLVPSAV-------RTTESLTF 730 Query: 219 SKSIA---SSINSTLVRTTSSAARSRCTAL--SNRDRGLK 323 SK+I + + T RS T L S RD+ LK Sbjct: 731 SKAILEKHADPTKYQIGKTKIFFRSGVTPLLESARDKALK 770 >SPAC10F6.05c |ubc6||ubiquitin conjugating enzyme Ubc6|Schizosaccharomyces pombe|chr 1|||Manual Length = 227 Score = 24.6 bits (51), Expect = 8.2 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 296 VIEQRPWTKNILEKGFDTTGTGFKSIESWWYKSRLGFP 409 +++ +P T+NILE + TG E Y L FP Sbjct: 24 LVDAKPATENILEWHYIITGPPDTPYEGGQYHGTLIFP 61 >SPCC1795.02c ||SPCC895.01|CaCA proton/calcium exchanger|Schizosaccharomyces pombe|chr 3|||Manual Length = 412 Score = 24.6 bits (51), Expect = 8.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 333 SNMFLVHGLCSITPCISSELRT 268 SN+ LV G+C +T I E+ T Sbjct: 154 SNLLLVFGMCLVTTGIRREITT 175 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 24.6 bits (51), Expect = 8.2 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +3 Query: 174 AWAAS*ASMTNALTCSKSIASSINSTLVRTTSSAARSRCTALSNRDRGLKTYWKKVSTQL 353 A ++S A T+ + + ASS N+ L TSS+A T +SN L + +QL Sbjct: 725 AMSSSSAIPTSVNSSTLITASSSNTLLSSITSSSAIVSSTTVSNISSNLPSATASSQSQL 784 Query: 354 EQVS 365 S Sbjct: 785 TNSS 788 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,901,140 Number of Sequences: 5004 Number of extensions: 35966 Number of successful extensions: 137 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 192109570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -