BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K13 (638 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 29 2.6 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 3.4 At4g22320.1 68417.m03227 expressed protein 28 6.0 At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to... 28 6.0 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 28 6.0 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 7.9 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 7.9 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 29.1 bits (62), Expect = 2.6 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 2/108 (1%) Frame = +3 Query: 111 ERQKKVLSLFQD--VDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPK 284 E+ +K+L+ Q +DQ+ D+ K+G Y EA IDN ++ + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 285 YYEFSIFYQKLREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQFL 428 EF +F Q + +F +F ++ F + + + L E +L Sbjct: 142 ALEFRLFRQHGFNVSEDVFDVF--MENCGKFDRDDIYGLISLYEASYL 187 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 159 NVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRI 269 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 87 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEE 248 K V +E QKK ++ ++ D++ DD KI +D VE D K VEE Sbjct: 115 KYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 365 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +3 Query: 36 ALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIG 188 ++V S VV Y F V + E +KK+ F + DQ DDE YK G Sbjct: 306 SVVGSGVVIFGLYIFLLGKVRLMKEECEKKLPCRFNEDDQEEDDDEQYKKG 356 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -1 Query: 398 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 252 S SG ++E +KV +++E K + + E+G++++L K DS+ F+ Sbjct: 595 SGSGQIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFE 644 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 7.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 293 LIVLGKITDSVQFQEFFNSFLIGVVI 216 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 7.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 293 LIVLGKITDSVQFQEFFNSFLIGVVI 216 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,442,024 Number of Sequences: 28952 Number of extensions: 268798 Number of successful extensions: 719 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -