BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K12 (378 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58758-11|AAB93425.2| 206|Caenorhabditis elegans Hypothetical p... 33 0.090 U53155-4|AAC48265.1| 619|Caenorhabditis elegans Hypothetical pr... 29 1.5 AL031635-10|CAA21037.2| 492|Caenorhabditis elegans Hypothetical... 27 5.9 AL021470-3|CAA16291.2| 414|Caenorhabditis elegans Hypothetical ... 26 7.8 AF099919-4|AAC68791.1| 230|Caenorhabditis elegans Hypothetical ... 26 7.8 AF025467-8|ABR92604.1| 443|Caenorhabditis elegans X-box promote... 26 7.8 AF025467-7|AAB71036.2| 485|Caenorhabditis elegans X-box promote... 26 7.8 >U58758-11|AAB93425.2| 206|Caenorhabditis elegans Hypothetical protein ZK1127.3 protein. Length = 206 Score = 32.7 bits (71), Expect = 0.090 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 70 FKNKDVDAVFGGAPEKGFYPLFQGCRPKLTLMMNTTK 180 F+N+ D + GG PE+ YP CRP L ++ + K Sbjct: 94 FRNQQRDLLMGGRPERTSYPPKYLCRPSLEMIEDKLK 130 >U53155-4|AAC48265.1| 619|Caenorhabditis elegans Hypothetical protein ZC513.3 protein. Length = 619 Score = 28.7 bits (61), Expect = 1.5 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 298 WRTHSTWEDN-RFCTISRILQQLSYWCSXRC 209 WRT + E + +F +SRIL+Q + W S C Sbjct: 542 WRTFAIREKSEKFPNVSRILRQKTSWVSKNC 572 >AL031635-10|CAA21037.2| 492|Caenorhabditis elegans Hypothetical protein Y47D3B.4 protein. Length = 492 Score = 26.6 bits (56), Expect = 5.9 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 175 TKFGKDY--DVEANIDXYTNKKAVEEFLKLYRIGYLP 279 TKFG++ D E N D ++ V+ +LKL ++G P Sbjct: 30 TKFGEENSPDYEDNFDAEKDEIFVKNYLKLMQMGRAP 66 >AL021470-3|CAA16291.2| 414|Caenorhabditis elegans Hypothetical protein Y17D7A.1 protein. Length = 414 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 144 TSLEKGIKPFFGRSTKHCVDIFVLEVIRFRDTTLDCTRAMSPA 16 T++ ++ F GR HCV EV+R +DCT + A Sbjct: 105 TNVPNSMEGFLGRP--HCVIFVDPEVVRCEKDLIDCTDLLRKA 145 >AF099919-4|AAC68791.1| 230|Caenorhabditis elegans Hypothetical protein F40G9.12 protein. Length = 230 Score = 26.2 bits (55), Expect = 7.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 13 SSGAHCPRAIQCG 51 +SG HCPR + CG Sbjct: 28 TSGDHCPRVLSCG 40 >AF025467-8|ABR92604.1| 443|Caenorhabditis elegans X-box promoter element regulatedprotein 7, isoform b protein. Length = 443 Score = 26.2 bits (55), Expect = 7.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 175 TKFGKDYDVEANIDXYTNKKAVEEFL 252 TKFG DY V+ ID N+K+ E+ L Sbjct: 178 TKFG-DYTVKIQIDDVENEKSTEDQL 202 >AF025467-7|AAB71036.2| 485|Caenorhabditis elegans X-box promoter element regulatedprotein 7, isoform a protein. Length = 485 Score = 26.2 bits (55), Expect = 7.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 175 TKFGKDYDVEANIDXYTNKKAVEEFL 252 TKFG DY V+ ID N+K+ E+ L Sbjct: 178 TKFG-DYTVKIQIDDVENEKSTEDQL 202 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,882,221 Number of Sequences: 27780 Number of extensions: 181976 Number of successful extensions: 484 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 557037416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -