BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K08 (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13908| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 29 2.9 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 29 2.9 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 29 3.8 SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_49338| Best HMM Match : Antimicrobial18 (HMM E-Value=5.8) 24 6.2 SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_3199| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 8.8 >SB_13908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 29.5 bits (63), Expect = 2.2 Identities = 21/74 (28%), Positives = 33/74 (44%) Frame = +3 Query: 54 HCDAKRFTRCGLVQELRRQGFDESLMSNWVCLVENESGRFTDKIGKVNKNGSRDYGLFQI 233 + D R+ ++ E R GF L W + E E R D+ + ++ + GLF I Sbjct: 270 NADDFRYQASDVIHE--RGGFTWDLFFTWKAIPEAEKKRRKDETDYI-RSPTMAGGLFAI 326 Query: 234 NDKYWCSTGSTPGK 275 + KY+ GS K Sbjct: 327 HKKYFYDLGSYDSK 340 >SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) Length = 571 Score = 29.1 bits (62), Expect = 2.9 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = -1 Query: 365 KLVAFVNLLCARSCHANVVSQ*LITSHVAILSRSGPGAAPVFVIDLEEAVV-SRSVLIHF 189 KL F N L SC N+ S + T+H I S + FVID + V+ S +I Sbjct: 170 KLYPFCNKL--DSCCNNLASFVINTTHFVINSNQFVIDSTQFVIDSTQFVIDSTQFVIDS 227 Query: 188 TNFVGKPSAFVLDKADPVTHQT 123 T FV + FV++ V + T Sbjct: 228 TRFVINSTRFVINSTRFVINLT 249 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Frame = +3 Query: 231 IND-KYWCSTGSTPGKDCHVTCNQLLTDDISVAATCAKKI--YKRHKFDAWYGWKNHCQH 401 +ND K C G T GKDCH+ N+ ++ TC + Y D + G +C+ Sbjct: 424 VNDYKCSCLQGYT-GKDCHIDINECSSNPCQYGGTCLNLLNGYACLCIDGYTGL--NCE- 479 Query: 402 GLPDISDC 425 DI DC Sbjct: 480 --KDIDDC 485 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 240 KYWCSTGSTPGKDCHVTCNQLLTDDISVAATCAKKI 347 K CSTG T GK+C V ++ T ATC +I Sbjct: 1539 KCQCSTGYT-GKNCEVNIDECATKPCLNGATCVDQI 1573 >SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1293 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/72 (25%), Positives = 31/72 (43%) Frame = -3 Query: 582 LW*EICQLFLDDFRFLNISIMHNILINIFVLNYNWNL*ISLEVAL*NLKPFLNSR*YLAV 403 LW + +F+D + + +N + +F +Y N S+ +L KPF N + Sbjct: 1216 LWEQSQNIFIDYKAMAKLRVQYNAVEELFYFDYTQNPAFSIVKSLAKHKPFPNPLLSSLL 1275 Query: 402 HVDSDFSIRTKR 367 HV +KR Sbjct: 1276 HVVEYIDQASKR 1287 >SB_49338| Best HMM Match : Antimicrobial18 (HMM E-Value=5.8) Length = 265 Score = 24.2 bits (50), Expect(2) = 6.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 273 KDCHVTCNQLLTDDISVAATCAKKIYKRHKFD 368 K C V N LL+ + V+ T ++KR+ F+ Sbjct: 231 KRCSVPENTLLSKQVDVSTTWKVLLHKRNLFE 262 Score = 22.2 bits (45), Expect(2) = 6.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 189 KVNKNGSRDYGLFQINDKYWCSTGSTPGKDCHV 287 +V KN + D I + + G+ P KDC + Sbjct: 188 EVEKNSASDSNKASIPRQKQITFGAKPAKDCQL 220 >SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2317 Score = 24.6 bits (51), Expect(2) = 8.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 375 YGWKNHCQHGLPDIS 419 YGW N C HG +S Sbjct: 2165 YGWNNCCTHGATPMS 2179 Score = 21.0 bits (42), Expect(2) = 8.6 Identities = 9/36 (25%), Positives = 13/36 (36%) Frame = +3 Query: 294 NQLLTDDISVAATCAKKIYKRHKFDAWYGWKNHCQH 401 N T + C K + + + GW N C H Sbjct: 2118 NNCCTHEYGWNNCCNNKYRWNNCYTHYNGWSNCCSH 2153 >SB_3199| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 399 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -1 Query: 251 APVFVIDLEEAVVSRSVLIHFTNFVGKPSAFVLDKADPVTHQTFIE 114 A +F+ + +V+ + F NF AF++ K +PV H T +E Sbjct: 77 ADLFITCVSMPIVTMVNIQGFQNFTSFTLAFIVCKLNPVIHGTSME 122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,999,656 Number of Sequences: 59808 Number of extensions: 356125 Number of successful extensions: 870 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 869 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -