BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K07 (445 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1076 - 30639835-30640898,30641613-30641915,30642008-306420... 28 2.9 04_04_0799 + 28143878-28145042,28145127-28145290,28146008-281460... 27 6.8 >04_04_1076 - 30639835-30640898,30641613-30641915,30642008-30642068, 30643076-30644380 Length = 910 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 367 GSARTDKHRQR*APATAPRSQQSAMLLELV 278 GS RT +R APAT PR ++ L LV Sbjct: 653 GSGRTANKHERPAPATRPRQRRKRKYLYLV 682 >04_04_0799 + 28143878-28145042,28145127-28145290,28146008-28146070, 28146268-28146491,28146850-28147555 Length = 773 Score = 27.1 bits (57), Expect = 6.8 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -3 Query: 314 EVSTVGYAAGAGFSQVRNNELGQVSGV 234 EV++ GY+AG+G + R + +G +S V Sbjct: 278 EVASGGYSAGSGGHRSRRSSIGSLSSV 304 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,445,589 Number of Sequences: 37544 Number of extensions: 159235 Number of successful extensions: 385 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 847740284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -