BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K06 (657 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69716-1|CAA93526.1| 486|Caenorhabditis elegans Hypothetical pr... 28 6.7 AF099003-1|AAC68742.1| 440|Caenorhabditis elegans Hypothetical ... 28 6.7 >Z69716-1|CAA93526.1| 486|Caenorhabditis elegans Hypothetical protein C04B4.1 protein. Length = 486 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 37 LKPRHGFDISIRSSCTILYLLFWCIRIEIIKC 132 +K R + ++SSC IL F+C +E++ C Sbjct: 140 IKFRENKIVEVKSSCNILSKDFYCPMMELVAC 171 >AF099003-1|AAC68742.1| 440|Caenorhabditis elegans Hypothetical protein Y59C2A.2 protein. Length = 440 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 167 NVFANEEDAKKSKGKVKHDDP 229 +VFA+EED +K+ +KH DP Sbjct: 222 HVFADEEDLEKALATMKHYDP 242 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,877,652 Number of Sequences: 27780 Number of extensions: 292630 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -