BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K04 (532 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30810.1 68417.m04365 serine carboxypeptidase S10 family prot... 31 0.48 At1g15280.2 68414.m01829 glycine-rich protein 30 0.85 At1g15280.1 68414.m01828 glycine-rich protein 30 0.85 At4g13460.1 68417.m02102 SET domain-containing protein (SUVH9) i... 29 1.5 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 4.5 At3g19170.1 68416.m02434 peptidase M16 family protein / insulina... 28 4.5 At1g17120.1 68414.m02086 amino acid permease family protein low ... 27 6.0 At5g14380.1 68418.m01680 hydroxyproline-rich glycoprotein family... 27 7.9 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 27 7.9 At1g72640.1 68414.m08399 expressed protein 27 7.9 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 27 7.9 At1g49630.3 68414.m05566 peptidase M16 family protein / insulina... 27 7.9 At1g49630.2 68414.m05565 peptidase M16 family protein / insulina... 27 7.9 At1g49630.1 68414.m05564 peptidase M16 family protein / insulina... 27 7.9 >At4g30810.1 68417.m04365 serine carboxypeptidase S10 family protein similar to serine-type carboxypeptidase (SP:P55748) [Hordeum vulgare] Length = 479 Score = 31.1 bits (67), Expect = 0.48 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 437 DYIKVRRMSIFGLDVWIL*GDLSDWEVSTAGLESFLVSGVGHGV 306 D + +R +S +G W L G + W AGL V G GH V Sbjct: 399 DALNLRPLSAYG--PWYLDGQVGGWSQQYAGLNFVTVRGAGHEV 440 >At1g15280.2 68414.m01829 glycine-rich protein Length = 585 Score = 30.3 bits (65), Expect = 0.85 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 120 DGDAQILRYDNDNIGVEGFQYGYETS-NGIQHQESGQLKNIGSEN 251 D + ++YDND G + ++ E S GI + +SG +K G N Sbjct: 53 DEEVGTVKYDNDEDGEDSYEDDEEESGGGIDNDKSGVVKEAGDMN 97 >At1g15280.1 68414.m01828 glycine-rich protein Length = 584 Score = 30.3 bits (65), Expect = 0.85 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 120 DGDAQILRYDNDNIGVEGFQYGYETS-NGIQHQESGQLKNIGSEN 251 D + ++YDND G + ++ E S GI + +SG +K G N Sbjct: 53 DEEVGTVKYDNDEDGEDSYEDDEEESGGGIDNDKSGVVKEAGDMN 97 >At4g13460.1 68417.m02102 SET domain-containing protein (SUVH9) identical to SUVH9 [Arabidopsis thaliana] GI:13517759; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH9 (SUVH9) GI:13517758 Length = 650 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +1 Query: 277 SLTSA--PME-SPTP*PTPLTRKDSSPAVLTSQSLKSP 381 SLT A P+E +P P P P + DSSP+V T + P Sbjct: 88 SLTGAIVPVEENPEPEPNPYSTSDSSPSVATQRPRPQP 125 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = +1 Query: 262 PSAGSSLTSAPMESP----TP*PTPLTRKDSSPAVLTSQSLKSP 381 PS S S+P+ SP TP PTP++ +SP ++ S P Sbjct: 547 PSPSSPTPSSPIPSPPTPSTP-PTPISPGQNSPPIIPSPPFTGP 589 >At3g19170.1 68416.m02434 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain Length = 1080 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 249 NEALAVSGQFSYVGPDGVTYSVTYTADEEGF 341 NEA+ + Q +YVG G YS Y D + Sbjct: 887 NEAIVIPTQVNYVGKAGNIYSTGYELDGSAY 917 >At1g17120.1 68414.m02086 amino acid permease family protein low similarity to SP|O43246 Cationic amino acid transporter-4 (CAT-4) {Homo sapiens}; contains Pfam profile PF00324: Amino acid permease Length = 590 Score = 27.5 bits (58), Expect = 6.0 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 2/94 (2%) Frame = -3 Query: 461 LRRCLITTDYIKVRRMSIFGLDVWIL*GDLSDWEVSTAGLESFLVSGVGHGVGDSIGADV 282 +RRCL D + + S+ G V+++ G + A + S+ +SGV + A+ Sbjct: 81 MRRCLTWWDLLWLSFGSVVGSGVFVITGQEARVGAGPAVVLSYAISGVSALLSVLCYAEF 140 Query: 281 R-ELPADGESFVL*AYV-LQLTTFLVLDTVGSLI 186 E+P G SF +Y+ ++L F+ G+++ Sbjct: 141 GVEIPVAGGSF---SYLRVELGDFIAFIAAGNIL 171 >At5g14380.1 68418.m01680 hydroxyproline-rich glycoprotein family protein identical to gi|4775268|emb|CAB42531 Length = 150 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 259 SPSAGSSLTSAPMESPTP*PTPLTRKDSSPAVLTSQSLKS 378 +PSA + +P +PT PT T+ S+P + + KS Sbjct: 23 APSASPKKSPSPTAAPTKAPTATTKAPSAPTKAPAAAPKS 62 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.1 bits (57), Expect = 7.9 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 271 GSSLTSAPMESPTP*PTPLTRKDSSPAVL--TSQSLKSP 381 G S S+P +SPT P T SPAV T+ K+P Sbjct: 21 GQSPISSPTKSPTTPSAPTTSPTKSPAVTSPTTAPAKTP 59 >At1g72640.1 68414.m08399 expressed protein Length = 330 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 186 YETSNGIQHQESGQLKNIGSENEALAVSGQFSY 284 YE+S GIQ + + K + ++E A+S Y Sbjct: 218 YESSGGIQAMMNSKAKKLAEQDENAAISSNVPY 250 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +1 Query: 241 AQRTKLSPSAGSSLTSAPMESPTP*PTPLTRKDSSPAVLTSQSLKSP 381 A + LSPS+ L+ +P P P P+ SP++ S SP Sbjct: 48 APPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSP 94 >At1g49630.3 68414.m05566 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain Length = 1080 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 249 NEALAVSGQFSYVGPDGVTYSVTYTADEEGF 341 NEA+ + Q +YVG G YS Y D + Sbjct: 886 NEAIVIPTQVNYVGKAGNIYSSGYKLDGSSY 916 >At1g49630.2 68414.m05565 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain Length = 1080 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 249 NEALAVSGQFSYVGPDGVTYSVTYTADEEGF 341 NEA+ + Q +YVG G YS Y D + Sbjct: 886 NEAIVIPTQVNYVGKAGNIYSSGYKLDGSSY 916 >At1g49630.1 68414.m05564 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain Length = 1080 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 249 NEALAVSGQFSYVGPDGVTYSVTYTADEEGF 341 NEA+ + Q +YVG G YS Y D + Sbjct: 886 NEAIVIPTQVNYVGKAGNIYSSGYKLDGSSY 916 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,768,441 Number of Sequences: 28952 Number of extensions: 179698 Number of successful extensions: 602 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 987020800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -