BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K03 (592 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25827| Best HMM Match : Matrix (HMM E-Value=5.6) 28 6.6 SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_25827| Best HMM Match : Matrix (HMM E-Value=5.6) Length = 550 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +3 Query: 150 TCHVNL*RRYYLVTSHRLMYVH*K--IRYNFCTAATYLYVLFVTFVTSHV 293 TCHV RY +VT H V +RY T + V +VT VT HV Sbjct: 337 TCHVFHVLRYVMVTCHVFQVVRYVMIVRYVTVTCHVFQVVRYVT-VTCHV 385 >SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1422 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +3 Query: 39 RPRRCPSRCASGSRPRKPPRQINQLHTYIQHNLCTAATCHVNL*RRYYLVTSHRL 203 R R P+ G RP +PP +++++ Y+ + AA H L R T+H L Sbjct: 1071 RHRGSPASEQHGDRPERPPEELSRM--YLPPHPDGAALMHPFLIHRESPFTAHHL 1123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,036,662 Number of Sequences: 59808 Number of extensions: 367315 Number of successful extensions: 749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -