BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J21 (465 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 85 3e-17 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 82 2e-16 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 82 2e-16 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 80 6e-16 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 70 9e-13 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 64 6e-11 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 54 4e-08 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 50 6e-07 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 50 8e-07 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 48 2e-06 At3g55640.1 68416.m06182 mitochondrial substrate carrier family ... 47 5e-06 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 46 1e-05 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 46 2e-05 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 46 2e-05 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 45 3e-05 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 44 7e-05 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 44 7e-05 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 43 1e-04 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 40 6e-04 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 37 0.006 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 37 0.006 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 37 0.008 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 36 0.010 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 36 0.010 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 36 0.013 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 36 0.013 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 36 0.018 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 36 0.018 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 35 0.024 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 35 0.031 At5g64970.1 68418.m08172 mitochondrial substrate carrier family ... 34 0.041 At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) id... 34 0.041 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 34 0.054 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 33 0.095 At4g24570.1 68417.m03521 mitochondrial substrate carrier family ... 32 0.17 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 32 0.17 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 32 0.22 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 32 0.22 At2g21040.1 68415.m02495 C2 domain-containing protein low simila... 31 0.29 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 31 0.29 At4g39460.1 68417.m05583 mitochondrial substrate carrier family ... 31 0.38 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 31 0.38 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 31 0.38 At4g27940.1 68417.m04009 mitochondrial substrate carrier family ... 31 0.51 At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 29 1.2 At4g00230.1 68417.m00025 subtilisin-like serine endopeptidase (X... 29 1.2 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 29 1.5 At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE) i... 29 1.5 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 29 2.0 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 29 2.0 At1g07980.1 68414.m00869 histone-like transcription factor (CBF/... 29 2.0 At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) id... 28 2.7 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 28 2.7 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 28 2.7 At1g18270.1 68414.m02280 ketose-bisphosphate aldolase class-II f... 28 2.7 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 27 4.7 At5g12220.1 68418.m01434 las1-like family protein similar to Las... 27 6.2 At5g64400.1 68418.m08090 expressed protein contains Pfam domain,... 27 8.3 At2g40150.1 68415.m04938 expressed protein 27 8.3 At1g71940.1 68414.m08316 expressed protein 27 8.3 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 84.6 bits (200), Expect = 3e-17 Identities = 46/81 (56%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAEDQRYKGIVDAFVRFPKEQG 402 F DFL GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G Sbjct: 79 FLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEG 138 Query: 403 LLSSWRGTFANVFGSFRIQAL 465 +L+ WRG ANV F QAL Sbjct: 139 MLALWRGNTANVIRYFPTQAL 159 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 82.2 bits (194), Expect = 2e-16 Identities = 47/81 (58%), Positives = 53/81 (65%), Gaps = 1/81 (1%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAEDQRYKGIVDAFVRFPKEQG 402 FA DFL GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G Sbjct: 80 FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEG 139 Query: 403 LLSSWRGTFANVFGSFRIQAL 465 S WRG ANV F QAL Sbjct: 140 FGSLWRGNTANVIRYFPTQAL 160 Score = 27.9 bits (59), Expect = 3.6 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = +1 Query: 223 AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQG 402 +F F G + + A PI+ V+ + + E +YK +DAF + K +G Sbjct: 285 SFFASFALGWVITNGAGLASYPIDTVRRRMMMTS-----GEAVKYKSSLDAFKQILKNEG 339 Query: 403 LLSSWRGTFANV 438 S ++G AN+ Sbjct: 340 AKSLFKGAGANI 351 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 82.2 bits (194), Expect = 2e-16 Identities = 47/81 (58%), Positives = 53/81 (65%), Gaps = 1/81 (1%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAEDQRYKGIVDAFVRFPKEQG 402 FA DFL GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G Sbjct: 80 FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEG 139 Query: 403 LLSSWRGTFANVFGSFRIQAL 465 S WRG ANV F QAL Sbjct: 140 FGSLWRGNTANVIRYFPTQAL 160 Score = 27.9 bits (59), Expect = 3.6 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = +1 Query: 223 AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQG 402 +F F G + + A PI+ V+ + + E +YK +DAF + K +G Sbjct: 285 SFFASFALGWVITNGAGLASYPIDTVRRRMMMTS-----GEAVKYKSSLDAFKQILKNEG 339 Query: 403 LLSSWRGTFANV 438 S ++G AN+ Sbjct: 340 AKSLFKGAGANI 351 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 80.2 bits (189), Expect = 6e-16 Identities = 45/81 (55%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAEDQRYKGIVDAFVRFPKEQG 402 FA DF+ GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R +++G Sbjct: 84 FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEG 143 Query: 403 LLSSWRGTFANVFGSFRIQAL 465 + S WRG ANV F QAL Sbjct: 144 IGSLWRGNTANVIRYFPTQAL 164 Score = 28.3 bits (60), Expect = 2.7 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS-KQIAEDQRYKGIVDAFVRFPKEQG 402 FA + +GG + A S V ++ + L S K+ ++++ G+VD + + K G Sbjct: 189 FAGNLASGGAAGASSLLFVYSLDYARTRLANDSKSAKKGGGERQFNGLVDVYKKTLKSDG 248 Query: 403 LLSSWRG 423 + +RG Sbjct: 249 IAGLYRG 255 Score = 27.5 bits (58), Expect = 4.7 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = +1 Query: 223 AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQG 402 +F F G + + A PI+ V+ + + E +YK DAF + K++G Sbjct: 289 SFFASFALGWLITNGAGLASYPIDTVRRRMMMTS-----GEAVKYKSSFDAFSQIVKKEG 343 Query: 403 LLSSWRGTFANV 438 S ++G AN+ Sbjct: 344 AKSLFKGAGANI 355 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 69.7 bits (163), Expect = 9e-13 Identities = 39/80 (48%), Positives = 51/80 (63%), Gaps = 1/80 (1%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAEDQRYKGIVDAFVRFPKEQG 402 F+ DF+ GG +A V+K+A APIERVKLLLQ Q + K + Y G+ + F R +E+G Sbjct: 10 FSADFVMGGAAAIVAKSAAAPIERVKLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEG 69 Query: 403 LLSSWRGTFANVFGSFRIQA 462 +LS WRG ANV F QA Sbjct: 70 VLSFWRGNQANVIRYFPTQA 89 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 63.7 bits (148), Expect = 6e-11 Identities = 37/86 (43%), Positives = 48/86 (55%), Gaps = 6/86 (6%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQ------RYKGIVDAFVRF 387 F KD LAG + V T VAPIER KLLLQ Q + I D+ R+KG+ D R Sbjct: 30 FQKDLLAGAVMGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRT 89 Query: 388 PKEQGLLSSWRGTFANVFGSFRIQAL 465 +E+G+LS WRG ++V + AL Sbjct: 90 VREEGVLSLWRGNGSSVLRYYPSVAL 115 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 343 EDQRYKGIVDAFVRFPKEQGLLSSWRGTFANVFGS 447 E Y+ +D + + + +GL S +RG +N+F S Sbjct: 274 EHPMYRSTLDCWKKIYRSEGLASFYRGALSNMFRS 308 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 54.4 bits (125), Expect = 4e-08 Identities = 26/71 (36%), Positives = 46/71 (64%) Frame = +1 Query: 226 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGL 405 FAK+ +AGG++ ++KTAVAP+ER+K+L Q + ++ + G+V + + K +GL Sbjct: 17 FAKELIAGGVTGGIAKTAVAPLERIKILFQTRR------DEFKRIGLVGSINKIGKTEGL 70 Query: 406 LSSWRGTFANV 438 + +RG A+V Sbjct: 71 MGFYRGNGASV 81 Score = 39.9 bits (89), Expect = 8e-04 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +1 Query: 235 DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQR-YKGIVDAFVRFPKEQGLLS 411 D +AG + + P++ V+ L Q K I +Q Y+GIVD F R +E G Sbjct: 116 DLVAGSFAGGTAVLFTYPLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARG 175 Query: 412 SWRGTFANVFGSF 450 +RG +++G F Sbjct: 176 LYRGVAPSLYGIF 188 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 50.4 bits (115), Expect = 6e-07 Identities = 25/83 (30%), Positives = 43/83 (51%) Frame = +1 Query: 190 SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIV 369 +N ++ LA A F AG ++ A +KT AP++R+KLL+Q + ++ G + Sbjct: 75 NNPLAILALVPKDAAIFAAGALAGAAAKTVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFI 134 Query: 370 DAFVRFPKEQGLLSSWRGTFANV 438 +A KE+G+ W+G V Sbjct: 135 EAITLIAKEEGVKGYWKGNLPQV 157 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 50.0 bits (114), Expect = 8e-07 Identities = 26/71 (36%), Positives = 40/71 (56%) Frame = +1 Query: 223 AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQG 402 + K AGG++ VS+TAVAP+ER+K+LLQVQ+ + +Y G V + +G Sbjct: 37 SICKSLFAGGVAGGVSRTAVAPLERMKILLQVQN-----PHNIKYSGTVQGLKHIWRTEG 91 Query: 403 LLSSWRGTFAN 435 L ++G N Sbjct: 92 LRGLFKGNGTN 102 Score = 29.9 bits (64), Expect = 0.89 Identities = 18/67 (26%), Positives = 33/67 (49%) Frame = +1 Query: 244 AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRG 423 AG + ++ +A P++ V+ L VQ + +Y+GI A +E+G + +RG Sbjct: 147 AGATAGIIAMSATYPMDMVRGRLTVQTANSPY----QYRGIAHALATVLREEGPRALYRG 202 Query: 424 TFANVFG 444 +V G Sbjct: 203 WLPSVIG 209 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 48.4 bits (110), Expect = 2e-06 Identities = 21/67 (31%), Positives = 35/67 (52%) Frame = +1 Query: 238 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSW 417 F AG + A +K+ AP++R+KLL+Q V ++ G ++A KE+G+ W Sbjct: 119 FFAGAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGIKGYW 178 Query: 418 RGTFANV 438 +G V Sbjct: 179 KGNLPQV 185 >At3g55640.1 68416.m06182 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 332 Score = 47.2 bits (107), Expect = 5e-06 Identities = 25/70 (35%), Positives = 36/70 (51%) Frame = +1 Query: 229 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLL 408 A LAGG++ A SKT AP+ R+ +L QVQ + A R I+ R E+GL Sbjct: 35 ASQLLAGGLAGAFSKTCTAPLSRLTILFQVQGMHTNAAA-LRKPSILHEASRILNEEGLK 93 Query: 409 SSWRGTFANV 438 + W+G + Sbjct: 94 AFWKGNLVTI 103 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 46.4 bits (105), Expect = 1e-05 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 1/87 (1%) Frame = +1 Query: 181 TT*SNKMSNLADPV-AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRY 357 +T S + +L D + AK +AGG + A++KTAVAP+ER+K+LLQ + D + Sbjct: 7 STLSADVMSLVDTLPVLAKTLIAGGAAGAIAKTAVAPLERIKILLQTR------TNDFKT 60 Query: 358 KGIVDAFVRFPKEQGLLSSWRGTFANV 438 G+ + + + G L ++G A+V Sbjct: 61 LGVSQSLKKVLQFDGPLGFYKGNGASV 87 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 45.6 bits (103), Expect = 2e-05 Identities = 28/70 (40%), Positives = 40/70 (57%) Frame = +1 Query: 229 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLL 408 +K LAGGI+ AVS+TA AP++R+K+ LQVQ + G+V + +E LL Sbjct: 205 SKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTN---------LGVVPTIKKIWREDKLL 255 Query: 409 SSWRGTFANV 438 +RG NV Sbjct: 256 GFFRGNGLNV 265 Score = 30.7 bits (66), Expect = 0.51 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQ 315 LAGG++ AV++TA+ P++ VK LQ Sbjct: 300 LAGGLAGAVAQTAIYPMDLVKTRLQ 324 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 45.6 bits (103), Expect = 2e-05 Identities = 19/36 (52%), Positives = 28/36 (77%) Frame = +1 Query: 238 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAE 345 F+AGGI+ A S+TA AP++R+K+LLQ+Q +I E Sbjct: 212 FIAGGIAGAASRTATAPLDRLKVLLQIQKTDARIRE 247 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 44.8 bits (101), Expect = 3e-05 Identities = 20/85 (23%), Positives = 41/85 (48%) Frame = +1 Query: 202 SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFV 381 +N ++ + A L GG S +++ +P + VK+ +Q RY G ++AF Sbjct: 106 TNNSESLPLATKALVGGFSGVIAQVVASPADLVKVRMQADGRLVSQGLKPRYSGPIEAFT 165 Query: 382 RFPKEQGLLSSWRGTFANVFGSFRI 456 + + +G+ W+G N+ +F + Sbjct: 166 KILQSEGVKGLWKGVLPNIQRAFLV 190 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 43.6 bits (98), Expect = 7e-05 Identities = 24/66 (36%), Positives = 40/66 (60%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 LAGG++ AVS+TA AP++R+K++LQVQ + + G++ + +E L+ +R Sbjct: 210 LAGGLAGAVSRTATAPLDRLKVVLQVQ---------RAHAGVLPTIKKIWREDKLMGFFR 260 Query: 421 GTFANV 438 G NV Sbjct: 261 GNGLNV 266 Score = 31.1 bits (67), Expect = 0.38 Identities = 21/68 (30%), Positives = 40/68 (58%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 +AGG++ A+++TA+ P++ VK LQ VS+ + +K D +VR +G + ++ Sbjct: 301 MAGGMAGALAQTAIYPMDLVKTRLQT-CVSEGGKAPKLWKLTKDIWVR----EGPRAFYK 355 Query: 421 GTFANVFG 444 G F ++ G Sbjct: 356 GLFPSLLG 363 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 43.6 bits (98), Expect = 7e-05 Identities = 24/66 (36%), Positives = 34/66 (51%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 LAGGI+ A SKT AP+ R+ +L Q+Q + + A I R KE+G + W+ Sbjct: 74 LAGGIAGAFSKTCTAPLARLTILFQIQGMQSE-AAILSSPNIWHEASRIVKEEGFRAFWK 132 Query: 421 GTFANV 438 G V Sbjct: 133 GNLVTV 138 Score = 33.9 bits (74), Expect = 0.054 Identities = 19/69 (27%), Positives = 36/69 (52%) Frame = +1 Query: 238 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSW 417 F++GG++ + +A P++ V+ L Q S Y+G+ AF +E+G+L + Sbjct: 180 FVSGGLAGLTAASATYPLDLVRTRLSAQRNSIY------YQGVGHAFRTICREEGILGLY 233 Query: 418 RGTFANVFG 444 +G A + G Sbjct: 234 KGLGATLLG 242 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 42.7 bits (96), Expect = 1e-04 Identities = 23/69 (33%), Positives = 37/69 (53%) Frame = +1 Query: 232 KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLS 411 ++ LAGGI+ A+SKT AP+ R+ +L Q+Q + + A R + R E+G + Sbjct: 43 QNLLAGGIAGAISKTCTAPLARLTILFQLQGMQSEGAVLSR-PNLRREASRIINEEGYRA 101 Query: 412 SWRGTFANV 438 W+G V Sbjct: 102 FWKGNLVTV 110 Score = 33.1 bits (72), Expect = 0.095 Identities = 19/69 (27%), Positives = 35/69 (50%) Frame = +1 Query: 238 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSW 417 F++GG++ + TA P++ V+ L Q + Y+GI F +E+G+L + Sbjct: 152 FVSGGLAGITAATATYPLDLVRTRLAAQRNAIY------YQGIEHTFRTICREEGILGLY 205 Query: 418 RGTFANVFG 444 +G A + G Sbjct: 206 KGLGATLLG 214 Score = 29.9 bits (64), Expect = 0.89 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 ++GG++ AVS TA P++ V+ +QV+ + G+ F K +G +R Sbjct: 248 VSGGLAGAVSSTATYPLDLVRRRMQVEGAGGRARVYN--TGLFGTFKHIFKSEGFKGIYR 305 Query: 421 G 423 G Sbjct: 306 G 306 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 40.3 bits (90), Expect = 6e-04 Identities = 25/84 (29%), Positives = 40/84 (47%) Frame = +1 Query: 193 NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVD 372 N+ + P FA +AG +S ++ TA+ P++ +K +Q+ + +YK I Sbjct: 56 NEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNMQIDPL--------KYKNITS 107 Query: 373 AFVRFPKEQGLLSSWRGTFANVFG 444 AF KEQGL RG + G Sbjct: 108 AFKTTIKEQGLKGFTRGWSPTLLG 131 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 37.1 bits (82), Expect = 0.006 Identities = 19/86 (22%), Positives = 41/86 (47%), Gaps = 7/86 (8%) Frame = +1 Query: 220 VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQH-VSKQIAED-QRYKGIVDAFVRFPK 393 ++F + F+ +A ++ P++ K+ LQ+Q + E+ +Y+G + + Sbjct: 10 ISFLETFICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAR 69 Query: 394 EQGLLSSWRGTFAN-----VFGSFRI 456 E+G+ W+G A ++G RI Sbjct: 70 EEGISGLWKGVIAGLHRQCIYGGLRI 95 Score = 33.1 bits (72), Expect = 0.095 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = +1 Query: 202 SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFV 381 S+ + + LA ++ A++ P + VK+ LQ + +RY G VDA+ Sbjct: 108 SDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYF 166 Query: 382 RFPKEQGLLSSWRGTFANV 438 K +G+ + W G N+ Sbjct: 167 TIVKLEGVSALWTGLGPNI 185 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 37.1 bits (82), Expect = 0.006 Identities = 19/86 (22%), Positives = 41/86 (47%), Gaps = 7/86 (8%) Frame = +1 Query: 220 VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQH-VSKQIAED-QRYKGIVDAFVRFPK 393 ++F + F+ +A ++ P++ K+ LQ+Q + E+ +Y+G + + Sbjct: 10 ISFLETFICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAR 69 Query: 394 EQGLLSSWRGTFAN-----VFGSFRI 456 E+G+ W+G A ++G RI Sbjct: 70 EEGISGLWKGVIAGLHRQCIYGGLRI 95 Score = 33.1 bits (72), Expect = 0.095 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = +1 Query: 202 SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFV 381 S+ + + LA ++ A++ P + VK+ LQ + +RY G VDA+ Sbjct: 108 SDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYF 166 Query: 382 RFPKEQGLLSSWRGTFANV 438 K +G+ + W G N+ Sbjct: 167 TIVKLEGVSALWTGLGPNI 185 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 36.7 bits (81), Expect = 0.008 Identities = 20/65 (30%), Positives = 33/65 (50%) Frame = +1 Query: 244 AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRG 423 AG I+ AV P + + +Q S + + YK +VDA R +++G+ S WRG Sbjct: 153 AGLIAGAVGSVVGNPADVAMVRMQADG-SLPLNRRRNYKSVVDAIDRIARQEGVSSLWRG 211 Query: 424 TFANV 438 ++ V Sbjct: 212 SWLTV 216 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 36.3 bits (80), Expect = 0.010 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +1 Query: 235 DFLAGGISAAVSKTAVAPIERVKLLLQVQH--------VSKQIAEDQRYKGIVDAFVRFP 390 D AG IS VS++ +P++ +K+ QVQ V ++ +Y G+V A Sbjct: 21 DASAGAISGGVSRSVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASKYTGMVQATKDIF 80 Query: 391 KEQGLLSSWRG 423 +E+G WRG Sbjct: 81 REEGFRGFWRG 91 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 36.3 bits (80), Expect = 0.010 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 8/87 (9%) Frame = +1 Query: 220 VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAED---QRYKGIVDAFVRFP 390 ++ K F +A V + P++ K+ LQ+Q +A D +Y+G++ Sbjct: 9 LSLPKTFACSAFAACVGEVCTIPLDTAKVRLQLQ--KSALAGDVTLPKYRGLLGTVGTIA 66 Query: 391 KEQGLLSSWRGTFAN-----VFGSFRI 456 +E+GL S W+G +FG RI Sbjct: 67 REEGLRSLWKGVVPGLHRQCLFGGLRI 93 Score = 34.7 bits (76), Expect = 0.031 Identities = 20/73 (27%), Positives = 35/73 (47%) Frame = +1 Query: 220 VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQ 399 V +K LAG + A+ P + VK+ LQ + +RY G ++A+ +++ Sbjct: 112 VPLSKKILAGLTTGALGIMVANPTDLVKVRLQAEG-KLAAGAPRRYSGALNAYSTIVRQE 170 Query: 400 GLLSSWRGTFANV 438 G+ + W G NV Sbjct: 171 GVRALWTGLGPNV 183 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 328 SKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRGTFANVFG 444 S+ + + YKG +D FV+ K G ++ ++G N FG Sbjct: 240 SRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPN-FG 277 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 35.9 bits (79), Expect = 0.013 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 6/69 (8%) Frame = +1 Query: 235 DFLAGGISAAVSKTAVAPIERVKLLLQVQ---HVSKQIAEDQ---RYKGIVDAFVRFPKE 396 D AGG++ A+S+ +P++ +K+ QVQ + + + Q +Y G+ +E Sbjct: 18 DASAGGVAGAISRMVTSPLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFRE 77 Query: 397 QGLLSSWRG 423 +GL WRG Sbjct: 78 EGLSGFWRG 86 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 35.9 bits (79), Expect = 0.013 Identities = 23/70 (32%), Positives = 34/70 (48%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 +AGG++ S A P++ VK LQ H + Y+GI D F + K++G WR Sbjct: 205 VAGGLAGVASWVACYPLDVVKTRLQQGHGA--------YEGIADCFRKSVKQEGYTVLWR 256 Query: 421 GTFANVFGSF 450 G V +F Sbjct: 257 GLGTAVARAF 266 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 35.5 bits (78), Expect = 0.018 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 328 SKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRGTFANV 438 S + D +YKG +D F + +++G WRGT A++ Sbjct: 91 SASVCSDNQYKGTLDVFYKIIRQEGFSRLWRGTNASL 127 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 35.5 bits (78), Expect = 0.018 Identities = 26/78 (33%), Positives = 39/78 (50%) Frame = +1 Query: 232 KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLS 411 K AG ++A VSKT +AP+ER+KL V+ +QR +V + QGL Sbjct: 50 KHLWAGAVAAMVSKTFLAPLERLKLEYTVR-------GEQRNLLVVAKSI--ATTQGLTG 100 Query: 412 SWRGTFANVFGSFRIQAL 465 W+G NV + +A+ Sbjct: 101 FWKGNLLNVLRTAPFKAV 118 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 35.1 bits (77), Expect = 0.024 Identities = 19/60 (31%), Positives = 31/60 (51%) Frame = +1 Query: 244 AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRG 423 AG + A++ T V P++ +K LQV + + A QR I+ + KE+G +RG Sbjct: 23 AGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRG 82 Score = 28.7 bits (61), Expect = 2.0 Identities = 14/66 (21%), Positives = 31/66 (46%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 +A I+ ++ P E ++ LQ Q + + +Y G++D + + +G+ +R Sbjct: 222 IASSIAKVIASILTYPHEVIRAKLQEQGQIRNA--ETKYSGVIDCITKVFRSEGIPGLYR 279 Query: 421 GTFANV 438 G N+ Sbjct: 280 GCATNL 285 Score = 28.3 bits (60), Expect = 2.7 Identities = 17/75 (22%), Positives = 33/75 (44%) Frame = +1 Query: 220 VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQ 399 ++ + +A + A + A P+ VK L Q + + YK ++ AF R E+ Sbjct: 115 LSIGSNMIAAAGAGAATSIATNPLWVVKTRLMTQGIRPGVVP---YKSVMSAFSRICHEE 171 Query: 400 GLLSSWRGTFANVFG 444 G+ + G ++ G Sbjct: 172 GVRGLYSGILPSLAG 186 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 34.7 bits (76), Expect = 0.031 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +1 Query: 241 LAGGISAAVSKTAVA-PIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSW 417 L G A VS+T + P+E VK L +Q YKGI DAF++ +E+G + Sbjct: 208 LLAGACAGVSQTLLTYPLELVKTRLTIQRGV--------YKGIFDAFLKIIREEGPTELY 259 Query: 418 RGTFANVFG 444 RG ++ G Sbjct: 260 RGLAPSLIG 268 Score = 29.9 bits (64), Expect = 0.89 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQV 318 L+G ++ AVS+T VAP+E ++ L V Sbjct: 115 LSGAVAGAVSRTVVAPLETIRTHLMV 140 >At5g64970.1 68418.m08172 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 428 Score = 34.3 bits (75), Expect = 0.041 Identities = 21/78 (26%), Positives = 37/78 (47%) Frame = +1 Query: 205 NLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVR 384 N A + K AG +A VS+T +AP+ER+KL + I ++ +++ R Sbjct: 124 NGAGALNTTKHLWAGAFAAMVSRTCIAPLERMKL--------EYIVRGEQ-GNLLELIQR 174 Query: 385 FPKEQGLLSSWRGTFANV 438 +G+ W+G N+ Sbjct: 175 IATNEGIRGFWKGNLVNI 192 >At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) identical to 36kDa-peroxisomal membrane protein (PMP36) GI:15146342 from [Arabidopsis thaliana] Length = 331 Score = 34.3 bits (75), Expect = 0.041 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 2/103 (1%) Frame = +1 Query: 145 SPSLSASIHPKRTT*SNKMSNL--ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQV 318 +PS+ ++ T K L ++ V + FL G ++ + P+ VK LQ Sbjct: 202 NPSMQFMLYETMLTKLKKKRALKGSNNVTALETFLLGAVAKLGATVTTYPLLVVKSRLQA 261 Query: 319 QHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRGTFANVFGS 447 + V+ + Q+YKG +DA ++ + +GL ++G + S Sbjct: 262 KQVTTG-DKRQQYKGTLDAILKMIRYEGLYGFYKGMSTKIVQS 303 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 33.9 bits (74), Expect = 0.054 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = +1 Query: 232 KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLS 411 + ++G ++ P + VK L Q S+ RYKG+V A E+GL++ Sbjct: 212 QSMISGFLAGTAGPFCTGPFDVVKTRLMAQ--SRDSEGGIRYKGMVHAIRTIYAEEGLVA 269 Query: 412 SWRG 423 WRG Sbjct: 270 LWRG 273 Score = 29.1 bits (62), Expect = 1.5 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +1 Query: 238 FLAG-GISAAVSKTAVAPIERVKLLLQVQH-VSKQIAEDQRYKGIVDAFVRFPKEQGLLS 411 FL+G G + V P E VK+ LQ Q +S ++ +YKG + +E+ +L Sbjct: 111 FLSGFGAGVLEALAIVTPFEVVKIRLQQQKGLSPELF---KYKGPIHCARTIVREESILG 167 Query: 412 SWRGTFANVFGSFRIQAL 465 W G V + QA+ Sbjct: 168 LWSGAAPTVMRNGTNQAV 185 Score = 27.5 bits (58), Expect = 4.7 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 ++G + V + PI+ +K LQ+ V YKGI + + +G+ + W+ Sbjct: 18 VSGSLGGVVEACCLQPIDVIKTRLQLDRVGA-------YKGIAHCGSKVVRTEGVRALWK 70 Query: 421 G 423 G Sbjct: 71 G 71 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 33.1 bits (72), Expect = 0.095 Identities = 20/61 (32%), Positives = 33/61 (54%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 +AGG++ A V P + VK +LQV ++ RY G +DAF + K +G+ ++ Sbjct: 218 MAGGVAGASFWGIVYPTDVVKSVLQVDDY-----KNPRYTGSMDAFRKILKSEGVKGLYK 272 Query: 421 G 423 G Sbjct: 273 G 273 >At4g24570.1 68417.m03521 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 32.3 bits (70), Expect = 0.17 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 +AGGI AAV A + R++ ++ +A+ + Y G+ DA K +G+ S WR Sbjct: 135 VAGGIGAAVGNPADVAMVRMQADGRLP-----LAQRRNYAGVGDAIRSMVKGEGVTSLWR 189 Query: 421 GT 426 G+ Sbjct: 190 GS 191 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 32.3 bits (70), Expect = 0.17 Identities = 20/79 (25%), Positives = 39/79 (49%) Frame = +1 Query: 229 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLL 408 A++FL+G ++ A++K +AP+E ++ + V S+ I +F+ ++QG Sbjct: 49 AREFLSGALAGAMTKAVLAPLETIRTRMIVGVGSRSIP---------GSFLEVVQKQGWQ 99 Query: 409 SSWRGTFANVFGSFRIQAL 465 W G N+ QA+ Sbjct: 100 GLWAGNEINMIRIIPTQAI 118 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 31.9 bits (69), Expect = 0.22 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +1 Query: 196 KMSNLADPVA-FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVD 372 K NL P + F GIS A++ P++ VK+ LQ+QHV ++ G+ Sbjct: 52 KPQNLIPPFSKVVSHFGISGISVALATGVTHPLDVVKVRLQMQHVGQR----GPLIGMTG 107 Query: 373 AFVRFPKEQGLLSSWRG 423 F++ K +G S + G Sbjct: 108 IFLQLMKNEGRRSLYLG 124 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 31.9 bits (69), Expect = 0.22 Identities = 15/61 (24%), Positives = 30/61 (49%) Frame = +1 Query: 244 AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRG 423 AG I+ A+ P + + +Q + + + YK ++DA + + +G+ S WRG Sbjct: 125 AGAIAGAIGAAVGNPADVAMVRMQADG-RLPLTDRRNYKSVLDAITQMIRGEGVTSLWRG 183 Query: 424 T 426 + Sbjct: 184 S 184 >At2g21040.1 68415.m02495 C2 domain-containing protein low similarity to phloem protein [Cucurbita maxima] GI:4164541; contains Pfam profile PF00168: C2 domain Length = 261 Score = 31.5 bits (68), Expect = 0.29 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = +3 Query: 246 WRYLRRRLQDSRSAHRARQIAAPSPARQQTDRRGPTLQGYRRRLRPLSQGAGSALILAWY 425 W+ +R+ S S R+ RQ+ R+G L G R P+ QGAGS+ + W Sbjct: 172 WKLVRQGAGSSGSWFVRRRFVREL-VRQEAVRQGAGLSGSRFVKEPVRQGAGSSGVGVWP 230 Query: 426 LR 431 L+ Sbjct: 231 LK 232 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 31.5 bits (68), Expect = 0.29 Identities = 22/72 (30%), Positives = 34/72 (47%) Frame = +1 Query: 232 KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLS 411 ++FL GGI+ A + + P++ +K LQ Q + + QR K I+ GL Sbjct: 34 REFLWGGIAGAFGEGMMHPVDTLKTRLQSQII---MNATQRQKSILQMLRTVWVGDGLKG 90 Query: 412 SWRGTFANVFGS 447 +RG V GS Sbjct: 91 FYRGIAPGVTGS 102 Score = 29.9 bits (64), Expect = 0.89 Identities = 21/73 (28%), Positives = 34/73 (46%) Frame = +1 Query: 247 GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRGT 426 GG++ +S P++ VK LQVQ +YKG +DA + +++G +RG+ Sbjct: 258 GGLAGGLSAYLTTPLDVVKTRLQVQ------GSTIKYKGWLDAVGQIWRKEGPQGFFRGS 311 Query: 427 FANVFGSFRIQAL 465 V AL Sbjct: 312 VPRVMWYLPASAL 324 >At4g39460.1 68417.m05583 mitochondrial substrate carrier family protein Length = 325 Score = 31.1 bits (67), Expect = 0.38 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 238 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGI 366 F+AGG + V +TA+ PI+ +K LQ +I Y G+ Sbjct: 58 FIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIVLKGLYSGL 100 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 31.1 bits (67), Expect = 0.38 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +1 Query: 262 AVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRGTFANV 438 A+ + P E VK +Q+Q + +RY +D V+ K G+ +RG A + Sbjct: 125 AIISFVLCPTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATL 183 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 31.1 bits (67), Expect = 0.38 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +1 Query: 241 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWR 420 + G + AV+ P++ +K L VQ Q YKG+ D +E+G + W+ Sbjct: 237 MIGAFAGAVTGVLTTPLDVIKTRLMVQGSGTQ------YKGVSDCIKTIIREEGSSALWK 290 Query: 421 G 423 G Sbjct: 291 G 291 >At4g27940.1 68417.m04009 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 413 Score = 30.7 bits (66), Expect = 0.51 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 352 RYKGIVDAFVRFPKEQGLLSSWRGTFANV 438 +YKG D F + +++GL WRGT A + Sbjct: 145 QYKGTFDVFTKIIRQEGLGRLWRGTNAGL 173 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 29.5 bits (63), Expect = 1.2 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 217 PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKE 396 P +A G +S ++ V P++ VK +Q+ + +YK I F KE Sbjct: 75 PAFYAACTFGGILSCGLTHMTVTPLDLVKCNMQI--------DPAKYKSISSGFGILLKE 126 Query: 397 QGLLSSWRGTFANVFG 444 QG+ +RG + G Sbjct: 127 QGVKGFFRGWVPTLLG 142 >At4g00230.1 68417.m00025 subtilisin-like serine endopeptidase (XSP1) identical to subtilisin-type serine endopeptidase XSP1 GI:6708179 from [Arabidopsis thaliana] Length = 749 Score = 29.5 bits (63), Expect = 1.2 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = +3 Query: 246 WRYLRRRLQDSRSAHRARQIAAPSPARQQTDRRGPTLQGYRRRLRPLSQGAGSALILAWY 425 +RY+ S + RQ+ P+P RGP G R L+P G ++ A+ Sbjct: 454 YRYINSTRSASAVIQKTRQVTIPAPFVASFSSRGPN-PGSIRLLKPDIAAPGIDILAAFT 512 Query: 426 LRQCL 440 L++ L Sbjct: 513 LKRSL 517 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 29.1 bits (62), Expect = 1.5 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +1 Query: 286 PIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSWRG 423 PI VK LQ+Q + + Q Y G++DAF KE+G + ++G Sbjct: 126 PIWLVKTRLQLQ---TPLHQTQPYSGLLDAFRTIVKEEGPRALYKG 168 >At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE) identical to C2H2 zinc-finger protein SERRATE GI:14486602 from [Arabidopsis thaliana] Length = 720 Score = 29.1 bits (62), Expect = 1.5 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 261 RRLQDSRSAHRARQIAAPSPARQQTDRR--GPTLQGYRRR 374 RR +DSR R I P P R++ DR P + Y+RR Sbjct: 49 RRERDSRERRDERDIERPPPNRRERDRSPLPPPRRDYKRR 88 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 28.7 bits (61), Expect = 2.0 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 264 RLQDSRSAHRARQIAAPSPARQQTDRRGPTLQGYRRRLRPLSQG 395 R D R R SP+R ++ RG T YRRR R +S G Sbjct: 705 RFSDRSDRDRFRSRRRFSPSRFRSPLRGRTPPRYRRRSRSVSPG 748 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 28.7 bits (61), Expect = 2.0 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = +1 Query: 238 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSW 417 FL+ + + A+ P E +K+ +Q Q + KG++D F R + +GL Sbjct: 115 FLSSASAQIFADMALCPFEAIKVRVQTQPMFA--------KGLLDGFPRVYRSEGLAGFH 166 Query: 418 RGTF 429 RG F Sbjct: 167 RGLF 170 >At1g07980.1 68414.m00869 histone-like transcription factor (CBF/NF-Y) family protein contains Pfam profile PF00808: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to Chromatin accessibility complex protein 1 (CHRAC-1) (CHRAC-15) (HuCHRAC15) (DNA polymerase epsilon subunit p15) (SP:Q9NRG0) {Homo sapiens} Length = 206 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 301 KLLLQVQHVSKQIAEDQRYKGIVDAFVRFPKEQGLLSSW 417 K + +H+S ++ DQRY+ + D+ K + L W Sbjct: 160 KKFIHYKHLSSVVSNDQRYEFLADSVPEKLKAEAALEEW 198 >At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) identical to GI:2392895 Length = 1196 Score = 28.3 bits (60), Expect = 2.7 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -2 Query: 230 ANATGSARFDILFDYVVLFGWILADKEGLRHTRNGKTTKNE 108 A+ GS +LF +V +FG IL +E +R R K + E Sbjct: 790 ASLAGSVAMGLLFSFVCIFGLILVGRE-MRKRRRKKEAELE 829 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 232 KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS 330 K LAGG+++A+S + + PI+ +K +Q +S Sbjct: 543 KSALAGGLASALSTSLMHPIDTIKTRVQASTLS 575 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 28.3 bits (60), Expect = 2.7 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 14/79 (17%) Frame = +1 Query: 232 KDFLAGGISAAVSKTAVAPIERVKL-------------LLQVQ-HVSKQIAEDQRYKGIV 369 K LAGGIS A S + P++ VK+ L++ V KQ + ++ IV Sbjct: 95 KSALAGGISCAFSAFLMHPVDTVKVQSIASFIGTVLGTTLRIPCEVLKQRLQANQFDNIV 154 Query: 370 DAFVRFPKEQGLLSSWRGT 426 +A V ++GL +RGT Sbjct: 155 EATVSTWHQEGLKGLFRGT 173 >At1g18270.1 68414.m02280 ketose-bisphosphate aldolase class-II family protein low similarity to KbaY (tagatose-1,6-bisphosphate aldolase) [Escherichia coli] GI:8895753; contains Pfam profile PF01116: Fructose-bisphosphate aldolase class-II Length = 1373 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 250 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAEDQRYKGIVDAFV 381 G+ + K AV + LQ+Q + KQ+ E + +VDA+V Sbjct: 81 GVMKGLQKDAVLLLSSTISTLQLQKLEKQLTEKREQIFVVDAYV 124 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 204 RHFVRLCGPLWVDTCGQGRTSAHTE 130 RH R CG ++ D C QGR + E Sbjct: 474 RHHCRNCGDVFCDKCTQGRIALTAE 498 >At5g12220.1 68418.m01434 las1-like family protein similar to Las1p [Saccharomyces cerevisiae] GI:495504; contains Pfam profile PF04031: Las1-like Length = 611 Score = 27.1 bits (57), Expect = 6.2 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 179 LFGWILADKEGLRHTRNGKTTKNEPP-IFNQEIWSYFVITGAQG 51 LF W+++ G +H + + + +PP IF E+ ++ GA G Sbjct: 339 LFAWLVSLLNGSKHFQRNSSLEVKPPSIFLMELIRRCLVLGALG 382 >At5g64400.1 68418.m08090 expressed protein contains Pfam domain, PF04933: Protein of unknown function (DUF657) Length = 144 Score = 26.6 bits (56), Expect = 8.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 261 RRLQDSRSAHRARQIAAPSPARQQTDRRGP 350 RR RSA R R AA SPA Q R P Sbjct: 3 RRSSGGRSAPRPRPAAARSPAPQPVHRAPP 32 >At2g40150.1 68415.m04938 expressed protein Length = 424 Score = 26.6 bits (56), Expect = 8.3 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -2 Query: 305 NLTRSMGATAVLETAAEIPPARKSLANATGSARFDILFDY--VVLFGW 168 +L R+ + V + IPP RKSL N TGS + DY V F W Sbjct: 147 SLNRNQWESMVCLVQSVIPPGRKSL-NQTGSLTVFKIQDYNATVEFYW 193 >At1g71940.1 68414.m08316 expressed protein Length = 272 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 389 GKRTKASTIPL*RWSSAICLLTCWTWSSNL 300 GKR+K PL RW A+ L +SS L Sbjct: 25 GKRSKLDRFPLSRWELAVSLGVFLVFSSGL 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,810,871 Number of Sequences: 28952 Number of extensions: 220834 Number of successful extensions: 705 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 782033640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -