BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J20 (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 27 0.32 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 24 3.0 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 23 5.2 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.8 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 9.0 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 27.5 bits (58), Expect = 0.32 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 181 AME*GADATVGYPMDNESAATLATPA 104 A+ GA ATV PMD + A A PA Sbjct: 246 ALAAGAPATVSTPMDKDDPAAAAAPA 271 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.2 bits (50), Expect = 3.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 20 CQTGVRLRYHLRAGNSRHQAGGPSREVPC 106 C R + LR G+ H+A G + EV C Sbjct: 479 CTGEDRSKRCLRCGDQTHKASGCTNEVKC 507 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 23.4 bits (48), Expect = 5.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 98 VPCWSGQRGRALVVHRVPDGRVCA 169 +P WS Q + + V+R+ + +CA Sbjct: 348 IPIWSNQECQEVYVNRIYNTTLCA 371 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +2 Query: 14 SCCQTGVRLRYHLRAGNSRHQAGGPSREVPCW 109 SC +L Y L A ++RH + + C+ Sbjct: 52 SCSDNAAQLTYRLPALSNRHNDNATAEYLSCY 83 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 154 VGYPMDNESAATLATPA 104 +GYP D +A T+AT A Sbjct: 646 MGYPFDRRTADTVATLA 662 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,395 Number of Sequences: 2352 Number of extensions: 8444 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -