BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J18 (617 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 29 3.9 06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155,332... 28 6.8 10_08_0355 - 17131178-17131268,17131376-17131429,17131521-171316... 27 9.0 >05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 Length = 518 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +2 Query: 320 NRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLS 451 NR+ R L++ +++ E I + CMKK+ ++N L +S Sbjct: 39 NRLLRSLVNIHEQETYSREIITEAIESCMKKQADNLVNTLDVIS 82 >06_01_0469 + 3322886-3323564,3324033-3324953,3325025-3325155, 3325237-3325317,3328173-3328820 Length = 819 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 265 TVLLRSSLRCVDCSCPAFERMG 200 TVLL +S + C C FERMG Sbjct: 388 TVLLDTSTMEISCGCRKFERMG 409 >10_08_0355 - 17131178-17131268,17131376-17131429,17131521-17131663, 17131812-17132096,17132168-17132301,17132383-17132556, 17132639-17132707,17132814-17132878,17133441-17133589, 17133747-17133989,17134119-17134255,17134340-17134561, 17134661-17134827,17136680-17136819 Length = 690 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = +1 Query: 223 NYNLHSV---KNYEAIRFLDIFEKTFVQSLQK 309 NYN+ V KN+ A+R DIF KT + +K Sbjct: 521 NYNIAIVSLKKNFNAVRLEDIFSKTVQEPSEK 552 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,892,644 Number of Sequences: 37544 Number of extensions: 343655 Number of successful extensions: 901 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 901 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -