BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J17 (325 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98429-1|CAA67071.1| 1188|Homo sapiens inositol polyphosphate 5-... 28 7.4 U84400-1|AAB49680.1| 1189|Homo sapiens SH2 containing inositol-5... 28 7.4 U57650-1|AAB53573.1| 1188|Homo sapiens SH2-containing inositol 5... 28 7.4 U53470-1|AAD00081.1| 1189|Homo sapiens signaling inositol polyph... 28 7.4 U50041-1|AAC50454.1| 1179|Homo sapiens signaling inositol polyph... 28 7.4 U50040-1|AAC50453.1| 976|Homo sapiens signaling inositol polyph... 28 7.4 BC113582-1|AAI13583.1| 1188|Homo sapiens inositol polyphosphate-... 28 7.4 BC113580-1|AAI13581.1| 1188|Homo sapiens inositol polyphosphate-... 28 7.4 BC099920-1|AAH99920.1| 1188|Homo sapiens inositol polyphosphate-... 28 7.4 >X98429-1|CAA67071.1| 1188|Homo sapiens inositol polyphosphate 5- phosphatase protein. Length = 1188 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 480 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 528 >U84400-1|AAB49680.1| 1189|Homo sapiens SH2 containing inositol-5-phosphatase protein. Length = 1189 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 481 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 529 >U57650-1|AAB53573.1| 1188|Homo sapiens SH2-containing inositol 5-phosphatase protein. Length = 1188 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 480 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 528 >U53470-1|AAD00081.1| 1189|Homo sapiens signaling inositol polyphosphate phosphatase SHIP II protein. Length = 1189 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 481 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 529 >U50041-1|AAC50454.1| 1179|Homo sapiens signaling inositol polyphosphate 5 phosphatase SIP-145 protein. Length = 1179 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 521 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 569 >U50040-1|AAC50453.1| 976|Homo sapiens signaling inositol polyphosphate 5 phosphatase SIP-110 protein. Length = 976 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 268 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 316 >BC113582-1|AAI13583.1| 1188|Homo sapiens inositol polyphosphate-5-phosphatase, 145kDa protein. Length = 1188 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 480 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 528 >BC113580-1|AAI13581.1| 1188|Homo sapiens inositol polyphosphate-5-phosphatase, 145kDa protein. Length = 1188 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 480 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 528 >BC099920-1|AAH99920.1| 1188|Homo sapiens inositol polyphosphate-5-phosphatase, 145kDa protein. Length = 1188 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 23 AIPLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAEASINRGGLGLDFV 169 AI + + V P+ E +I I +++ G+A N+G +G+ F+ Sbjct: 480 AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFM 528 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,964,853 Number of Sequences: 237096 Number of extensions: 741272 Number of successful extensions: 1254 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1627597384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -