BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J17 (325 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 23 0.92 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 23 0.92 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 3.7 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 4.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 4.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 20 8.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 20 8.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 20 8.6 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 23.0 bits (47), Expect = 0.92 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 29 PLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAE 130 P+ K +E V+ Q +KGIA + +EN E Sbjct: 89 PVYKMIEVVHAGNADDIQLVKGIANECIENAKGE 122 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 23.0 bits (47), Expect = 0.92 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 29 PLIKRVEEVYFQFPQPEQKIKGIAIKDLENGLAE 130 P+ K +E V+ Q +KGIA + +EN E Sbjct: 89 PVYKMIEVVHAGNADDIQLVKGIANECIENAKGE 122 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 3.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 121 AIL*IFDRYTFD 86 A+L IFD YT+D Sbjct: 493 ALLDIFDTYTYD 504 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 20.6 bits (41), Expect = 4.9 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 321 FFFFLHKDI 295 F+FFLHK + Sbjct: 257 FYFFLHKQV 265 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 20.6 bits (41), Expect = 4.9 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 321 FFFFLHKDI 295 F+FFLHK + Sbjct: 257 FYFFLHKQV 265 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 19.8 bits (39), Expect = 8.6 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 76 RTENQRYSDQRFREWLSGGIDQPRRIRSRLC*HQTEERKG 195 RT +RYS R RE S ++ R ++ +R+G Sbjct: 281 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRG 320 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 242 NNTVKHKFLLH 210 NNT+ H F+ H Sbjct: 1733 NNTLLHSFMYH 1743 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 242 NNTVKHKFLLH 210 NNT+ H F+ H Sbjct: 1729 NNTLLHSFMYH 1739 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,695 Number of Sequences: 438 Number of extensions: 1869 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7093251 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -