BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J13 (620 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77270.1 68414.m08999 expressed protein 31 0.47 At5g40942.1 68418.m04973 ribonucleoside-diphosphate reductase sm... 31 0.81 At3g14850.2 68416.m01876 expressed protein 30 1.1 At3g14850.1 68416.m01877 expressed protein 30 1.1 At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type f... 29 3.3 At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 29 3.3 At2g20595.1 68415.m02409 expressed protein 28 5.7 At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly ... 27 7.6 >At1g77270.1 68414.m08999 expressed protein Length = 682 Score = 31.5 bits (68), Expect = 0.47 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 57 TRYISDRRCANIRRNSAAVVMRVRKKLKTGL-RIRRQDLPQPVPLVLREGQDAQRFENRE 233 TRY+ D + N R + + + R K+LKT + R + + P+V + +D QR +NRE Sbjct: 390 TRYVRDSQEKNTRNDESQTIFRASKRLKTEIGRADHNSISKTNPVV--KTKDIQR-KNRE 446 >At5g40942.1 68418.m04973 ribonucleoside-diphosphate reductase small chain, putative / ribonucleotide reductase, putative similar to ribonucleotide reductase R2 [Nicotiana tabacum] GI:1044912; contains Pfam profile PF00268: Ribonucleotide reductase, small chain Length = 231 Score = 30.7 bits (66), Expect = 0.81 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 583 GFRLIFHNLHS-VVARTRVFDAQARVRLCGAIQQARVAVSDAVATA 449 GF++ N+HS ++ RT+ + + + +C A++ R V DA++ A Sbjct: 101 GFQIAIENIHSEILLRTKFDEDRLKAIVCDAVEIEREFVCDALSCA 146 >At3g14850.2 68416.m01876 expressed protein Length = 321 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 461 GVTYGNPCLLNCATQSNPSLSIEHPGPCDNRVKVVENQ--PESNTVIVVDYTM 613 GV +G P +C Q P L ++PG V V++ S V ++D TM Sbjct: 223 GVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLKRALGKISKPVTLLDITM 275 >At3g14850.1 68416.m01877 expressed protein Length = 253 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 461 GVTYGNPCLLNCATQSNPSLSIEHPGPCDNRVKVVENQ--PESNTVIVVDYTM 613 GV +G P +C Q P L ++PG V V++ S V ++D TM Sbjct: 155 GVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLKRALGKISKPVTLLDITM 207 >At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 144 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 109 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 249 P+SC C R PVCG D TY C D +++VK+G C+ Sbjct: 68 PASCPVQCFRP-DPVCGEDSVTYWCGC-----ADALCHGVRVVKQGACD 110 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 142 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 249 PVCG+DG TY C D ++VK+G C+ Sbjct: 53 PVCGTDGVTYWCGC-----PDAACHGARVVKKGACD 83 >At2g20595.1 68415.m02409 expressed protein Length = 69 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 247 EEADPCVCTFIYAPVCGTD-GNTYPNKCSLECSRPLPP 357 EE+ +C + C +D G+ Y N C +EC P PP Sbjct: 24 EESGGTICFRQCSQPCRSDDGSCYEN-CKIECGGPKPP 60 >At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly identical to SP|P15455 [Plant Mol Biol 11:805-820 (1988)]; contains Pfam profile PF00190 Cupin and Prosite 11-S plant seed storage proteins signature PS00305 Length = 472 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 280 YAPVCGTDGNTYPNKCSLECSRPLPPSLEMKHRGECQEVKVAD 408 YA G G +PN+C L+ L PS +K E ++V D Sbjct: 21 YAAQQGQQGQQFPNECQLDQLNALEPSHVLK--SEAGRIEVWD 61 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,169,314 Number of Sequences: 28952 Number of extensions: 306942 Number of successful extensions: 918 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -