Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_J11
         (163 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    19   4.7  
DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.    18   8.3  
AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    18   8.3  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 19.0 bits (37), Expect = 4.7
 Identities = 11/43 (25%), Positives = 19/43 (44%)
 Frame = -2

Query: 159  VTVNQSQPVPSSVMLGDMPMETALPRNLSISA*ATTKSAEIIT 31
            VTV+ S  VP+ +   D    T    ++++   A      +IT
Sbjct: 1297 VTVSPSASVPAKIASFDDTFTTTYKEDVTLPCLAVGLPPPVIT 1339


>DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.
          Length = 314

 Score = 18.2 bits (35), Expect = 8.3
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = -3

Query: 107 CRWRRPYLEIYRY 69
           C+   PY+  YRY
Sbjct: 246 CQPAVPYVPFYRY 258


>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory
          receptor candidate 34 protein.
          Length = 324

 Score = 18.2 bits (35), Expect = 8.3
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 95 RPYLEIYRY 69
          RPYL+ Y Y
Sbjct: 45 RPYLKSYTY 53


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,546
Number of Sequences: 336
Number of extensions: 464
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 33
effective length of database: 111,497
effective search space used:  2229940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 34 (18.5 bits)