BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J09 (157 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50311-1|AAA92307.1| 492|Caenorhabditis elegans Hypothetical pr... 29 0.45 U23177-7|AAM22053.1| 867|Caenorhabditis elegans Hypothetical pr... 25 9.6 AC024800-5|AAF60724.1| 966|Caenorhabditis elegans Hypothetical ... 25 9.6 AC024751-1|ABF71719.1| 261|Caenorhabditis elegans Hypothetical ... 25 9.6 AC006810-5|AAF59629.2| 516|Caenorhabditis elegans Cytochrome p4... 25 9.6 >U50311-1|AAA92307.1| 492|Caenorhabditis elegans Hypothetical protein C25E10.5 protein. Length = 492 Score = 29.1 bits (62), Expect = 0.45 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 48 FLICRVITRCVF*YTYTFEFWS 113 FL+C + + CVF TY +EF S Sbjct: 345 FLVCTIASGCVFLITYPYEFSS 366 >U23177-7|AAM22053.1| 867|Caenorhabditis elegans Hypothetical protein C56G2.1a protein. Length = 867 Score = 24.6 bits (51), Expect = 9.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 27 SVNIILSFLICRVITRCVF*YTYTFEFWSNKMSKHM 134 S LS+ C VITR + W+N ++K++ Sbjct: 32 STTTSLSYAACDVITRHLISMLLEISNWTNDLAKYL 67 >AC024800-5|AAF60724.1| 966|Caenorhabditis elegans Hypothetical protein Y49F6A.1 protein. Length = 966 Score = 24.6 bits (51), Expect = 9.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 14 YELKVSKYNSKFPYLP 61 Y LK Y KFPYLP Sbjct: 379 YYLKQYNYKLKFPYLP 394 >AC024751-1|ABF71719.1| 261|Caenorhabditis elegans Hypothetical protein Y18H1A.14 protein. Length = 261 Score = 24.6 bits (51), Expect = 9.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 2 DLSVYELKVSKYNSKFPYLPSDN 70 +L+ EL V+ + +K YLP+DN Sbjct: 146 ELTELELLVNGHTAKIRYLPADN 168 >AC006810-5|AAF59629.2| 516|Caenorhabditis elegans Cytochrome p450 family protein 32B1 protein. Length = 516 Score = 24.6 bits (51), Expect = 9.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -1 Query: 157 SLKLAVEYMCLLILFDQNSNVYVY*NTHRVITRQIRKLR 41 +L L + Y LI F Q ++ + + ++ TR+ +KLR Sbjct: 5 ALVLLLTYFAYLI-FRQKDDILQFLHVRKICTREFKKLR 42 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,236,537 Number of Sequences: 27780 Number of extensions: 44029 Number of successful extensions: 80 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 12,740,198 effective HSP length: 32 effective length of database: 11,851,238 effective search space used: 225173522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -