BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J08 (523 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0023 + 146841-147002,147962-148036,148181-148234,148284-14... 29 2.3 >02_01_0023 + 146841-147002,147962-148036,148181-148234,148284-148388, 148736-148836,148937-148992,149284-149324,149427-149527, 149629-149724,149905-149969,150048-150119,150537-150772, 150874-150904,151020-151165,151264-151365,151469-151513, 151614-151780,151812-152214 Length = 685 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 159 SAAPNN*NWSPRISRRKIGRYQFSLEYWVL 70 +AA ++ W R RRKIGR F Y+VL Sbjct: 9 AAAVHHEGWMVRYGRRKIGRSFFHTRYFVL 38 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,476,614 Number of Sequences: 37544 Number of extensions: 161589 Number of successful extensions: 336 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -