BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J08 (523 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7132| Best HMM Match : PT (HMM E-Value=2) 28 5.4 SB_14900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_7132| Best HMM Match : PT (HMM E-Value=2) Length = 204 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +2 Query: 11 SSIIRMFTVRSVNETVQWIYRTQYSKEN*YLPIFRRDMRG 130 SSII + + S N TV + RTQ S L +FRR + G Sbjct: 29 SSIIAVLCILS-NGTVLYFQRTQRSPSTKGLQVFRRPLNG 67 >SB_14900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 369 NHNAVVG*LIIISKSRLIARWWSITCQQHHLEYFNKK 479 N NA V ++I+S+ +I WSI Q+ H + +K Sbjct: 160 NRNAQVNEMVILSEPNVIRGKWSICHQRFHRKEKKRK 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,570,274 Number of Sequences: 59808 Number of extensions: 200422 Number of successful extensions: 417 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -