BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J06 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 52 3e-09 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 51 9e-09 AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochr... 23 1.6 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 3.7 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 22 3.7 DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 22 4.9 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 52.4 bits (120), Expect = 3e-09 Identities = 25/72 (34%), Positives = 40/72 (55%) Frame = +2 Query: 341 AVKVFRILYFAKDYDYFIKTACWLRERINGGMFVYALTAAVFHRSDCVGITLPAPYEIYP 520 A K+ RI A+ D + A + R+R+N +F YA + A+ HR D + LP+ ++P Sbjct: 91 AGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLHRPDTQNLDLPSFIHVFP 150 Query: 521 YFFVDSHVINKA 556 +VDS V +A Sbjct: 151 DKYVDSQVFARA 162 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 50.8 bits (116), Expect = 9e-09 Identities = 26/72 (36%), Positives = 40/72 (55%) Frame = +2 Query: 341 AVKVFRILYFAKDYDYFIKTACWLRERINGGMFVYALTAAVFHRSDCVGITLPAPYEIYP 520 A ++ I ++ D + A + R+R+N +F YAL+ A+ HR D I LP+ E +P Sbjct: 91 AGRLIDIFLGMRNVDDLLSVAVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIESFP 150 Query: 521 YFFVDSHVINKA 556 +VDS V KA Sbjct: 151 DKYVDSKVFAKA 162 >AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q6 protein. Length = 125 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +2 Query: 188 IKEVAREYMLEENTDKYSKSDVVTKFMETFKMGMLPRGEVF-VHTNA 325 IKE R + +Y+ D VTK T G + +F +H NA Sbjct: 51 IKETLRLFPSVPFISRYASEDFVTKTGNTIPEGTVLHIHIFDLHRNA 97 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -2 Query: 156 FKSFMMQISFIFTSAFMRLSFPI 88 +++ ++S +FTS M+L FP+ Sbjct: 123 WRNLRTKLSPVFTSGKMKLMFPL 145 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 394 DEVVIVLGEVQYAENFNGLFHLQRI--CVNEDLTTR*HAHF 278 DE+V VLG++ +N L ++ + + E L HF Sbjct: 41 DEMVTVLGDLHRKPTYNNLQEMKYLERAIKESLRLYPSVHF 81 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 109 EGRCENEGDLHHETLELRTAANCVRGHQGSRE 204 EG C +EG +TL ++ C + +Q +E Sbjct: 52 EGPCTSEGRELKKTLPDALSSGCTKCNQKQKE 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,016 Number of Sequences: 336 Number of extensions: 3207 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -