BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J06 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) 38 0.007 At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) simi... 37 0.010 At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) 33 0.16 At5g55480.1 68418.m06910 glycerophosphoryl diester phosphodieste... 31 0.86 At5g58050.1 68418.m07265 glycerophosphoryl diester phosphodieste... 30 1.1 At5g20940.1 68418.m02488 glycosyl hydrolase family 3 protein bet... 30 1.1 At4g26690.1 68417.m03846 glycerophosphoryl diester phosphodieste... 29 2.0 At5g27290.1 68418.m03258 expressed protein predicted proteins, A... 28 4.6 At5g21222.1 68418.m02532 protein kinase family protein contains ... 28 4.6 At2g27110.2 68415.m03258 far-red impaired responsive protein, pu... 28 4.6 At2g27110.1 68415.m03257 far-red impaired responsive protein, pu... 28 4.6 At1g43780.1 68414.m05043 serine carboxypeptidase S10 family prot... 28 4.6 At5g66520.1 68418.m08387 pentatricopeptide (PPR) repeat-containi... 28 6.1 At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, puta... 28 6.1 At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding ... 28 6.1 At1g66970.1 68414.m07615 glycerophosphoryl diester phosphodieste... 28 6.1 At1g03190.2 68414.m00297 DNA repair protein / transcription fact... 27 8.0 At1g03190.1 68414.m00296 DNA repair protein / transcription fact... 27 8.0 >At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) Length = 135 Score = 37.5 bits (83), Expect = 0.007 Identities = 28/72 (38%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = +2 Query: 86 VIGKDSLMKADVKMKEICIMKLLNYV-LQPTVYE---DIKEVAREYMLEENTDKYSK-SD 250 VI KDS K K + C +KL+NY L PT Y D+KEVA L+ K + + Sbjct: 53 VIRKDSAKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALQSKDKKVAALKE 112 Query: 251 VVTKFMETFKMG 286 K E FK G Sbjct: 113 AKAKLEERFKTG 124 >At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) similar to 60S RIBOSOMAL PROTEIN L27 GB:P41101 from [Solanum tuberosum] Length = 135 Score = 37.1 bits (82), Expect = 0.010 Identities = 28/72 (38%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = +2 Query: 86 VIGKDSLMKADVKMKEICIMKLLNYV-LQPTVYE---DIKEVAREYMLEENTDKYSK-SD 250 VI KDS K K + C +KL+NY L PT Y D+KEVA L+ K + + Sbjct: 53 VIRKDSAKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALKSKDKKVTALKE 112 Query: 251 VVTKFMETFKMG 286 K E FK G Sbjct: 113 AKAKLEERFKTG 124 >At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) Length = 135 Score = 33.1 bits (72), Expect = 0.16 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 5/72 (6%) Frame = +2 Query: 86 VIGKDSLMKADVKMKEICIMKLLNYV-LQPTVYE---DIKEVAREYMLEENTDKYSK-SD 250 VI KDS K K + C K++NY + PT Y D+K V + K + + Sbjct: 53 VIRKDSAKKTAKKSRVKCFFKVINYQHVMPTRYTLDLDLKNVVSADAISSKDKKVTALKE 112 Query: 251 VVTKFMETFKMG 286 KF E FK G Sbjct: 113 AKAKFEERFKTG 124 >At5g55480.1 68418.m06910 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family; similar to Glycerophosphoryl diester phosphodiesterase precursor (Glycerophosphodiester phosphodiesterase) (Surface-exposed lipoprotein D) (Protein D) (ImmunoglobulinD-binding protein) (IGD-binding protein) (SP:Q06282) {Haemophilus influenzae} Length = 766 Score = 30.7 bits (66), Expect = 0.86 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 9/123 (7%) Frame = +2 Query: 173 TVYEDIKEVAREYM--LEENTDKYSKSDVVTK--FMETFKMGMLPRGEVFVHTNALQMEQ 340 TVY+ ++E R+ + E+ K++ + V++K T + + ++ Q+ Sbjct: 562 TVYK-VEETIRDILDTAIEDIKKFADAVVISKKSVFPTSESFTTGQTKLVERLQKFQLPV 620 Query: 341 AVKVFRILYFAKDYDYFIKTACWLRER-----INGGMFVYALTAAVFHRSDCVGITLPAP 505 V+VFR + ++ +D+F + ING + + LTAA + R+ C+ P Sbjct: 621 YVEVFRNEFVSQPWDFFADATVEINSHVTGAGINGTITEFPLTAARYKRNSCLTRKDVPP 680 Query: 506 YEI 514 Y I Sbjct: 681 YMI 683 >At5g58050.1 68418.m07265 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family; similar to Glycerophosphoryl diester phosphodiesterase precursor (Glycerophosphodiester phosphodiesterase) (Surface-exposed lipoprotein D) (Protein D) (ImmunoglobulinD-binding protein) (IGD-binding protein) (SP:Q06282) {Haemophilus influenzae} Length = 753 Score = 30.3 bits (65), Expect = 1.1 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 5/64 (7%) Frame = +2 Query: 344 VKVFRILYFAKDYDYF----IKTACWLRER-INGGMFVYALTAAVFHRSDCVGITLPAPY 508 V V R Y A +DYF I+ A ++ R ++G + + TA + RS C + PY Sbjct: 608 VSVLRNEYIAIAFDYFSDPTIELATFIAGRGVDGVITEFPATATRYLRSPCSDLNKDQPY 667 Query: 509 EIYP 520 I P Sbjct: 668 AILP 671 >At5g20940.1 68418.m02488 glycosyl hydrolase family 3 protein beta-glucosidase, common nasturtium, PIR:T10521 Length = 626 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 481 AVRPVEDCSSESIYEHAPVNAFP*PASSFDEVVIVLGEVQYAENF 347 AV+ D ++ IY P F A FD ++ +GE YAE F Sbjct: 476 AVKKTVDPKTQVIYNQNPDTNFV-KAGDFDYAIVAVGEKPYAEGF 519 >At4g26690.1 68417.m03846 glycerophosphoryl diester phosphodiesterase family protein weak similarity to glycerophosphodiester phosphodiesterase [Borrelia hermsii] GI:1399038; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 759 Score = 29.5 bits (63), Expect = 2.0 Identities = 30/118 (25%), Positives = 51/118 (43%), Gaps = 18/118 (15%) Frame = +2 Query: 209 YMLEENTDKYSKSDV--VTKFMETF---KMGMLPRGEVFVHTNA-----LQMEQA---VK 349 Y +EEN S + + KF + K+ + P + F+ T LQ Q V+ Sbjct: 557 YKVEENIRDILDSAIEDIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVE 616 Query: 350 VFRILYFAKDYDYFIKTACWLRERI-----NGGMFVYALTAAVFHRSDCVGITLPAPY 508 +F+ + ++ YD+F + I NG + + TAA + R+ C+G PY Sbjct: 617 LFQNEFLSQPYDFFADATVEINSYITGAGINGTITEFPFTAARYKRNLCLGRKETIPY 674 >At5g27290.1 68418.m03258 expressed protein predicted proteins, Arabidopsis thaliana Length = 341 Score = 28.3 bits (60), Expect = 4.6 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +2 Query: 263 FMETFKMGMLPRGEVFVHTNALQMEQAVKVFRILYFAKDYDYFIKTACWLRERINGGMFV 442 F+ + +G+LPRG ALQ E ++ + F DY++ E +N G Sbjct: 191 FLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFV-DYEFL--------EEVNSG--- 238 Query: 443 YALTAAVFHRSDCVGIT-LPAPYEIYPY 523 ++A + +R C+ + + Y +Y Y Sbjct: 239 -KVSATMLNRFSCIALAGVATEYLLYGY 265 >At5g21222.1 68418.m02532 protein kinase family protein contains Pfam profile: PF00069 protein kinase domain Length = 831 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +2 Query: 83 VVIGKDSLMK---ADVKMKEICIMKLLNYVLQPTVYEDIKEVAREYMLEE 223 +++ KD ++K A+ +EI IMKL+N+ +YE + A+ Y++ E Sbjct: 42 MILDKDKVLKHKMAEQIKREISIMKLINHPNVVQLYEVLASKAKIYIVLE 91 >At2g27110.2 68415.m03258 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 302 EVFVHT-NALQMEQAVKVFRILYFAKDYDYFIKTACWLRERIN 427 E F HT N ++ + FR+ F D +I T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At2g27110.1 68415.m03257 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 302 EVFVHT-NALQMEQAVKVFRILYFAKDYDYFIKTACWLRERIN 427 E F HT N ++ + FR+ F D +I T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At1g43780.1 68414.m05043 serine carboxypeptidase S10 family protein similar to serine carboxylase II-3 GB:CAA55478 GI:474392 from [Hordeum vulgare] Length = 479 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 473 SDCVGITLPAPYEIYPYFFVDSHVINKAFMMKMTKAAT-DPVLMNYYGI 616 SD +G+T+ + Y F DSH I+K + +A T +NYY I Sbjct: 242 SDELGLTIMNQCDFEDYTFTDSHNISKLCEAAVNQAGTIITQYVNYYDI 290 >At5g66520.1 68418.m08387 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 620 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 248 DVVTKFMETFKMGMLPRGEVFVHT-NALQMEQAVKVFRILYFAKDYDYFIK 397 + ++KFME KMG+ P F A V+ ++++++ + DY +K Sbjct: 331 EAISKFMEMQKMGIKPNVITFTAVLTACSYTGLVEEGKLIFYSMERDYNLK 381 >At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, putative / long-chain acyl-CoA synthetase, putative similar to acyl-CoA synthetase (MF7P) gi:1617270 from Brassica napus Length = 666 Score = 27.9 bits (59), Expect = 6.1 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 300 PRGSMPILKVSMNFVTTSDFEYLSVFS-SSIYSLATSLMSSYTVGCST*FKSFMMQIS 130 P GSM I+ N + EY++V + ++YS + S + G S F+SF++ I+ Sbjct: 508 PNGSMKIIDRKKNIFKLAQGEYVAVENLENVYSQVEVIESIWVYGNS--FESFLVAIA 563 >At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding bromodomain-containing protein low similarity to SP|P51123 Transcription initiation factor TFIID 230 kDa subunit {Drosophila melanogaster}; contains Pfam profiles: PF00439 bromodomain, PF00240: Ubiquitin family Length = 1700 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/52 (23%), Positives = 22/52 (42%) Frame = +3 Query: 171 QLCTRTSRKSRGNICWRKTRTSTRNPMLLRNSWRPSKWACYRVVRSSFTQMR 326 Q+C+ R + G CW K R + P+ L P Y + + +++ Sbjct: 783 QVCSDLERDANGKACWSKKRKFDKIPLGLNTLVAPEDVCSYESMLAGLFRLK 834 >At1g66970.1 68414.m07615 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family Length = 763 Score = 27.9 bits (59), Expect = 6.1 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Frame = +2 Query: 329 QMEQAVKVFRILYFAKDYDYFIKTACWLRERI-----NGGMFVYALTAAVFHRSDCVGIT 493 Q+ V++FR + ++ YD+F + I NG + + TAA + R+ C+G Sbjct: 617 QLPVYVELFRNEFVSQAYDFFSDATVEINAYIYGAGINGTITEFPFTAARYKRNRCLGRE 676 Query: 494 LPAPY 508 PY Sbjct: 677 EVPPY 681 >At1g03190.2 68414.m00297 DNA repair protein / transcription factor protein (UVH6) identical to DNA repair/transcription factor protein (UVH6) gi:22651569 gb:AY090788 Length = 758 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +2 Query: 461 VFHRSDCVGITLP--APYEIYPYFFVDSHVINKAFMMKMTKAATDPVLM 601 VF R V IT +P ++YP + V++++F M MT+ P+++ Sbjct: 447 VFDRFQSVVITSGTLSPIDLYPRLLNFTPVVSRSFKMSMTRDCICPMVL 495 >At1g03190.1 68414.m00296 DNA repair protein / transcription factor protein (UVH6) identical to DNA repair/transcription factor protein (UVH6) gi:22651569 gb:AY090788 Length = 758 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +2 Query: 461 VFHRSDCVGITLP--APYEIYPYFFVDSHVINKAFMMKMTKAATDPVLM 601 VF R V IT +P ++YP + V++++F M MT+ P+++ Sbjct: 447 VFDRFQSVVITSGTLSPIDLYPRLLNFTPVVSRSFKMSMTRDCICPMVL 495 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,029,686 Number of Sequences: 28952 Number of extensions: 276441 Number of successful extensions: 791 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -