BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J04 (555 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 29 0.14 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 3.9 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 28.7 bits (61), Expect = 0.14 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = -1 Query: 351 KKKRLSLQQKFDTIESEVNNLNKVIRSF*ADLNPLWLH-IIWEPRINP-----EDK*DNY 190 K KRL +Q TIE+++ + + L PL LH I EP P E++ D+Y Sbjct: 1004 KMKRLEFEQILQTIETKLQETKDTLPHWQLQLKPLKLHEIPEEPPQEPLKEYTEEELDSY 1063 Query: 189 K 187 K Sbjct: 1064 K 1064 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 3.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 443 WVTNFFEHEYCTALQGR 393 W+ FEH + TA QG+ Sbjct: 3032 WINEIFEHFFNTANQGK 3048 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 546,982 Number of Sequences: 2352 Number of extensions: 10495 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -