BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J02 (375 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 115 7e-28 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 26 0.53 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 2.8 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 22 6.5 Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 22 8.7 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 115 bits (276), Expect = 7e-28 Identities = 49/63 (77%), Positives = 58/63 (92%) Frame = +2 Query: 182 LFEKRTKNFAIGQDIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKT 361 LFEKR KN+ IGQ++QP RDLSRFV+WPKYIRIQR +A+LQ+RLK+PPPINQFTQTLDK Sbjct: 37 LFEKRVKNYGIGQNVQPKRDLSRFVKWPKYIRIQRHRAILQKRLKIPPPINQFTQTLDKP 96 Query: 362 TAK 370 TA+ Sbjct: 97 TAQ 99 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.8 bits (54), Expect = 0.53 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 271 YSHPASKGCVTASSQSAAANQPVHP 345 + HP G + A SQ QPVHP Sbjct: 165 HHHPGLTGLMQAPSQQQQHLQPVHP 189 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 2.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 112 DREKSSGRSTCGEES*AQEDCKPS 183 DR ++ GRS C S + D +PS Sbjct: 884 DRSEAGGRSLCTNGSSSGRDSQPS 907 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 239 DLSRFVRWPKYIRIQRQKAVLQRRLKVPPP 328 D++R++ W K I+ R A+ ++L+ P P Sbjct: 343 DVARWLEWRKKIKEYRMTAM--KKLQPPKP 370 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 21.8 bits (44), Expect = 8.7 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 34 GHVSIRGR*IT 66 GH+SIRGR +T Sbjct: 59 GHISIRGRILT 69 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 362,032 Number of Sequences: 2352 Number of extensions: 5939 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28804305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -