BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_J02 (375 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 0.51 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 0.51 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 23 1.2 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 23 1.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 3.6 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 6.3 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 0.51 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 199 KELCYWPGHPANQR-SIPFRAMAEIYSHPASKGCVTASSQSAAA 327 ++ CY+P HP+ Q S +S ASK ++ SS + A Sbjct: 385 EKTCYYPYHPSTQEDSEEHLTPKRFHSRAASKEDLSPSSLADGA 428 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 0.51 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 199 KELCYWPGHPANQR-SIPFRAMAEIYSHPASKGCVTASSQSAAA 327 ++ CY+P HP+ Q S +S ASK ++ SS + A Sbjct: 385 EKTCYYPYHPSTQEDSEEHLTPKRFHSRAASKEDLSPSSLADGA 428 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 23.0 bits (47), Expect = 1.2 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 169 DCKPSIREENKELCYWPGHPANQ-RSIPFRAM 261 DC I +E L YW G+ AN R P +A+ Sbjct: 58 DCFVRIPKEQGFLSYWRGNLANVIRYFPTQAL 89 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 23.0 bits (47), Expect = 1.2 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 169 DCKPSIREENKELCYWPGHPANQ-RSIPFRAM 261 DC I +E L YW G+ AN R P +A+ Sbjct: 58 DCFVRIPKEQGFLSYWRGNLANVIRYFPTQAL 89 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 3.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 271 YSHPASKGCVTASSQSAAANQPV 339 Y H S+G V S +A N PV Sbjct: 1831 YDHYGSRGSVGRRSVGSARNIPV 1853 Score = 20.6 bits (41), Expect = 6.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 290 KAVLQRRLKVPPPINQFTQT 349 + L+ ++ VPP I QF+ T Sbjct: 572 RGTLEVQVMVPPTIQQFSFT 591 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 20.6 bits (41), Expect = 6.3 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = -2 Query: 245 IDLWLAGC 222 +D+W+AGC Sbjct: 262 LDVWMAGC 269 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,688 Number of Sequences: 438 Number of extensions: 1780 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9052365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -