BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I22 (467 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58197| Best HMM Match : Ribosomal_L5_C (HMM E-Value=3) 28 3.4 SB_58653| Best HMM Match : Ribosomal_L5_C (HMM E-Value=2.7) 27 7.7 SB_42297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_29614| Best HMM Match : Flavodoxin_1 (HMM E-Value=0.22) 27 7.7 SB_24215| Best HMM Match : PSK (HMM E-Value=6.2) 27 7.7 SB_49594| Best HMM Match : Ribosomal_L5_C (HMM E-Value=2.6) 27 7.7 SB_44579| Best HMM Match : Sialidase (HMM E-Value=8.3) 27 7.7 SB_9722| Best HMM Match : EGF_CA (HMM E-Value=2.4e-06) 27 7.7 >SB_58197| Best HMM Match : Ribosomal_L5_C (HMM E-Value=3) Length = 582 Score = 28.3 bits (60), Expect = 3.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 RVLYNYHLLIFNYLHYISFCQ 69 R +YNY L + ++LH+I CQ Sbjct: 150 RTVYNYILALEDFLHFILICQ 170 >SB_58653| Best HMM Match : Ribosomal_L5_C (HMM E-Value=2.7) Length = 440 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 RVLYNYHLLIFNYLHYISFCQ 69 R +YNY L + ++LH+I CQ Sbjct: 151 RTVYNYILALEDFLHFILNCQ 171 >SB_42297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 RVLYNYHLLIFNYLHYISFCQ 69 R +YNY L + ++LH+I CQ Sbjct: 283 RTVYNYILALEDFLHFILNCQ 303 >SB_29614| Best HMM Match : Flavodoxin_1 (HMM E-Value=0.22) Length = 726 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 RVLYNYHLLIFNYLHYISFCQ 69 R +YNY L + ++LH+I CQ Sbjct: 342 RTVYNYILALEDFLHFILNCQ 362 >SB_24215| Best HMM Match : PSK (HMM E-Value=6.2) Length = 254 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 RVLYNYHLLIFNYLHYISFCQ 69 R +YNY L + ++LH+I CQ Sbjct: 151 RTVYNYILALEDFLHFILNCQ 171 >SB_49594| Best HMM Match : Ribosomal_L5_C (HMM E-Value=2.6) Length = 383 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 RVLYNYHLLIFNYLHYISFCQ 69 R +YNY L + ++LH+I CQ Sbjct: 151 RTVYNYILALEDFLHFILNCQ 171 >SB_44579| Best HMM Match : Sialidase (HMM E-Value=8.3) Length = 172 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 197 IVLVSLPIP*K*NPKKMSMVIYLQVPILLV*FTGFTYTY 81 ++L+SL IP + KK + Y +P GFTY Y Sbjct: 56 LLLLSLEIPERGTGKKYGALTYSNLPTKTWHHVGFTYDY 94 >SB_9722| Best HMM Match : EGF_CA (HMM E-Value=2.4e-06) Length = 673 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 RVLYNYHLLIFNYLHYISFCQ 69 R +YNY L + ++LH+I CQ Sbjct: 151 RTVYNYILALEDFLHFILNCQ 171 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,947,586 Number of Sequences: 59808 Number of extensions: 114736 Number of successful extensions: 155 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -