BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I20 (540 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.60 SB_46548| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) 28 5.6 SB_9503| Best HMM Match : Bac_DNA_binding (HMM E-Value=3.3) 27 7.4 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_25545| Best HMM Match : ABC_tran (HMM E-Value=0.00042) 27 9.8 SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) 27 9.8 >SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) Length = 366 Score = 31.1 bits (67), Expect = 0.60 Identities = 22/71 (30%), Positives = 36/71 (50%) Frame = -1 Query: 294 TLHRQAYLAFIVDISIDGKTIPVLTGVTMTNIWRGKPPRVPRGNRSLCGKPRRLLYHQLS 115 T+ AYL+ + + GK + +LTG +T GKP + +L GKP L ++ Sbjct: 55 TIEASAYLSVRGIVRLPGKPV-ILTGEQVT--LTGKPVTLTGKPVTLTGKPVTLAGKPVT 111 Query: 114 MLLKPVPVVSK 82 ++ KPV + K Sbjct: 112 LMGKPVSLTGK 122 >SB_46548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = -3 Query: 400 LSVYLHVGKLHVVCEESRHINFPIEGES*GHCVETYTPPTSVSRLHSRHI 251 ++ YL++ ++ + ++ RHI + G++ G V + SV R H + I Sbjct: 105 VAAYLNIPEIIRIAKKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVI 154 >SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +3 Query: 9 SSAARS-RCTALSNRDRGLKTYWKKVS 86 S A+R+ RC +S D L+TYW+KV+ Sbjct: 238 SQASRADRCLPVSRSDSILETYWRKVN 264 >SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) Length = 649 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 75 KKVSTQLEQVSRASRVGGIRVALAFRTGFCY 167 KK+ST+ + RAS V +++ F TG CY Sbjct: 613 KKMSTRSMGLKRASSVKYVQLLYLFNTGKCY 643 >SB_9503| Best HMM Match : Bac_DNA_binding (HMM E-Value=3.3) Length = 110 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 192 GKPPRVPRGNRSLCGKPRRLLYHQLSMLLKPVPVVSKPFSNMF 64 GKPPR P+ SL + H + + KP+P+ + N F Sbjct: 65 GKPPRKPQKTASLKEVLEKFSNHNVIIAPKPMPIETDVNGNDF 107 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 192 GKPPRVPRGNRSLCGKPRRLLYHQLSMLLKPVPVVSKPFSNMF 64 GKPPR P+ SL + H + + KP+P+ + N F Sbjct: 800 GKPPRKPQKTASLKEVLEKFSNHNVIIAPKPMPIETDVNGNDF 842 >SB_25545| Best HMM Match : ABC_tran (HMM E-Value=0.00042) Length = 146 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -1 Query: 492 MSESKYVRSSFFITISDMSISLMVLDIVDKSFLYTCTSVNFMLFVKKVGI 343 +S +V +S ++ +S + L V S + +S++F F+K VG+ Sbjct: 38 VSSLSFVVNSLSFIVNSLSFVVSSLSFVVNSLSFVVSSLSFWSFLKDVGL 87 >SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -1 Query: 492 MSESKYVRSSFFITISDMSISLMVLDIVDKSFLYTCTSVNFMLFVKKVGI 343 +S +V +S ++ +S + L V S + +S++F F+K VG+ Sbjct: 383 VSSLSFVVNSLSFIVNSLSFVVSSLSFVVNSLSFVVSSLSFWSFLKDVGL 432 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,892,502 Number of Sequences: 59808 Number of extensions: 353150 Number of successful extensions: 896 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -