BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I17 (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 3.3 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 23 7.5 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 23 7.5 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.2 bits (50), Expect = 3.3 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 407 GSMVAKLKLKGIDGRAPPGVEPAALFDSTREISP 508 G +V +L+G GRAPP E A L E+ P Sbjct: 420 GYLVVLSRLRG--GRAPPETERARLESIVTELFP 451 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 23.0 bits (47), Expect = 7.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 524 FRCPGLVRFPVLSQIKP 474 F CPGL++F ++ + P Sbjct: 222 FLCPGLLKFTGINSLSP 238 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 207 SWIVARRTSAKAFAKGVFINQERKLEVRR 293 +W++ RT KG Q +KLE R+ Sbjct: 23 TWVMVYRTEKYQKLKGEVEKQSKKLEKRK 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,463 Number of Sequences: 2352 Number of extensions: 13595 Number of successful extensions: 34 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -