BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I16 (600 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006648-5|AAF39853.1| 701|Caenorhabditis elegans Hypothetical ... 29 1.9 U46671-5|AAA85750.2| 147|Caenorhabditis elegans Hypothetical pr... 29 3.3 AL117204-13|CAB55128.1| 286|Caenorhabditis elegans Hypothetical... 28 4.4 AF039719-12|AAB96758.1| 293|Caenorhabditis elegans Hypothetical... 28 5.9 AF016425-6|AAY86242.1| 104|Caenorhabditis elegans Hypothetical ... 28 5.9 Z49132-7|CAA88986.1| 403|Caenorhabditis elegans Hypothetical pr... 27 7.7 >AC006648-5|AAF39853.1| 701|Caenorhabditis elegans Hypothetical protein F59H6.2 protein. Length = 701 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +1 Query: 490 WTTCSRTRLVHL--RPPLTPMSLIVMTTLWGGKLNLFKT 600 WT +R+RL + RPP T ++ +T + G K+NL T Sbjct: 416 WTQSTRSRLYNSFHRPPRTSRDVLKLTHVSGRKINLILT 454 >U46671-5|AAA85750.2| 147|Caenorhabditis elegans Hypothetical protein C14E2.5 protein. Length = 147 Score = 28.7 bits (61), Expect = 3.3 Identities = 21/89 (23%), Positives = 33/89 (37%) Frame = +3 Query: 330 TKTHIPGFGDKMTAAGKVNLFHNDNHDFSAKAFATKNLPNIPQVPNFNTVGAGVDYMFKD 509 T IP F + A K LF +N D + + N + NF + + Y +D Sbjct: 10 TAMEIPTFARALNAEPKSQLFLKENQDSQPRLLVSTAEKNGSVISNFKS--SWNHYYIED 67 Query: 510 KIGASATAAHTDVFNRNDYSLGGKTESLQ 596 + + T VF+ L E +Q Sbjct: 68 NSSSDENISQTTVFDSESCRLDDLAEYVQ 96 >AL117204-13|CAB55128.1| 286|Caenorhabditis elegans Hypothetical protein Y116A8C.22 protein. Length = 286 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 152 CTNCQLRRHLRCYGQGTYNWKRKSQAQC 235 CT CQ HL+C G + W SQ QC Sbjct: 256 CTKCQKWVHLKCTGIRSKQW--NSQFQC 281 >AF039719-12|AAB96758.1| 293|Caenorhabditis elegans Hypothetical protein K04F10.7 protein. Length = 293 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 413 QCQSIRH*KPAKYSSSSELQHCRCRSGLHVQGQDWC 520 QCQ + AKY Q+C+ + H Q WC Sbjct: 25 QCQKCQK-NEAKYGKPGTCQYCKLNAAFHDQKCVWC 59 >AF016425-6|AAY86242.1| 104|Caenorhabditis elegans Hypothetical protein F59A7.11 protein. Length = 104 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 24 LVSVLLVGVNSRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDGTS 182 L++ LL + V+ PG + ED + R RR G TV +DG++ Sbjct: 4 LINSLLFTIAILAVVWGYPGQQADHVEDLTKNRNEPRARRDLGTETVRADGSA 56 >Z49132-7|CAA88986.1| 403|Caenorhabditis elegans Hypothetical protein ZK666.7 protein. Length = 403 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +3 Query: 252 LTNQMKLGAATAGLAY--DNVNGHGATLTKTHIPGF 353 L +MK+ A A +AY DNVNG L++ PG+ Sbjct: 180 LATRMKVDVAIATVAYGQDNVNGFLRQLSQIATPGY 215 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,771,117 Number of Sequences: 27780 Number of extensions: 321288 Number of successful extensions: 820 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -