BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I13 (622 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical pr... 31 0.66 AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical ... 27 8.2 >Z81579-9|CAN99688.1| 225|Caenorhabditis elegans Hypothetical protein R13H4.2a protein. Length = 225 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 308 LTEDIGFNSYYYYFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRY 454 L +D ++ YYY+ + ++ S RY + Y+N Y TRY Sbjct: 71 LYDDYWYDKYYYFSPLYRSTYYPSRRYSYSDYLPNPYYWNNYGSYWTRY 119 >AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical protein K03H6.2 protein. Length = 348 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 356 HLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYY 457 HLPF + + + H R EI+YN + + Y+ Sbjct: 264 HLPFQYELVDHDKMYHHRTEIWYNNDMSIGSSYH 297 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,823,626 Number of Sequences: 27780 Number of extensions: 285778 Number of successful extensions: 695 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1353389824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -