BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I13 (622 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63410.1 68418.m07960 leucine-rich repeat transmembrane prote... 32 0.35 At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00... 31 0.47 At5g39480.1 68418.m04781 F-box family protein contains Pfam:PF00... 31 0.62 At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.81 At3g62160.1 68416.m06984 transferase family protein low similari... 29 2.5 At5g49850.1 68418.m06173 jacalin lectin family protein similar t... 28 5.7 At5g13700.1 68418.m01595 polyamine oxidase, putative similar to ... 28 5.7 >At5g63410.1 68418.m07960 leucine-rich repeat transmembrane protein kinase, putative contains similarity to receptor-like protein kinase Length = 680 Score = 31.9 bits (69), Expect = 0.35 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 5/87 (5%) Frame = +2 Query: 251 YANYSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERY---GNLKHRR--GE 415 Y + SN FL+ + +L+ + + F + +F+ LP W+ S Y + K + GE Sbjct: 145 YLDLSNNFLFGSVPPKLSTMVKLETFRFDHNFFNGTLPSWFDSYWYLKVLSFKSNKLSGE 204 Query: 416 IYYNFYQQLTTRYYFERLTNGLGSIPE 496 ++ + T Y R + GS+P+ Sbjct: 205 LHSSLLSLSTIEYIDLRANSLSGSLPD 231 >At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 571 Score = 31.5 bits (68), Expect = 0.47 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 195 TMQRLLIMEL*KRKSSMCITPTIPTLSFTIMK 290 T+QR+ + E+ K+ C++P +PT +FT K Sbjct: 522 TLQRINLGEILKKSLGSCVSPLLPTKNFTYTK 553 >At5g39480.1 68418.m04781 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 568 Score = 31.1 bits (67), Expect = 0.62 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 156 LRFIALKCKTVFFTMQRLLIMEL*KRKSSMCITPTIPTLSFTIMK 290 L F+ + K V T+QRL + E+ K+ C+ P P+ +FT M+ Sbjct: 507 LAFVWKETKVVI-TLQRLNLTEILKKGLGSCVPPLPPSKNFTYMR 550 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.81 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 535 GIVTSLNRRVPREFRYGTQAVCKT 464 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 532 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 443 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At5g49850.1 68418.m06173 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 596 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/59 (20%), Positives = 25/59 (42%) Frame = +2 Query: 398 KHRRGEIYYNFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRP 574 K +G F ++ + F + G + WY+P+ GY + ++++P P Sbjct: 386 KTSKGRTSRTFGERTSDSVEFVIESKGCAVVGFHGWYAPLGAGYITALGAHFYPMPLPP 444 >At5g13700.1 68418.m01595 polyamine oxidase, putative similar to SP|O64411 Polyamine oxidase precursor (EC 1.5.3.11) from Zea mays Length = 472 Score = 27.9 bits (59), Expect = 5.7 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 113 YEVYPQFFVNMDTLLKIYRTKMQDGILHDAKAINYGIVKEEEQYVYYANY 262 Y++ +F V + YR K+ + ++ N +VK E+ VY ANY Sbjct: 188 YKMAEEFLVTSHGNILDYRLKLNQVVREVQQSRNGVVVKTEDGSVYEANY 237 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,941,411 Number of Sequences: 28952 Number of extensions: 260072 Number of successful extensions: 746 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -