BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I11 (414 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.8 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 3.2 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 3.2 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 3.2 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 3.2 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 4.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 4.2 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 4.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 5.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 5.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 5.5 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 1.8 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -3 Query: 169 NASWKASDTTTLSPLTMFGAGSLNIFETPNLGIKGLRSN-LLFISNFGISNFT 14 N+ W AS L+P + G L+ E ++ L N L + N N T Sbjct: 127 NSVWGASRFLELAPDSFLGLRELHTLEIVESNVQALPVNSLCSLDNLQTLNLT 179 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 297 ILYKIK*FLLVLIPINIRLY 356 +LY I+ L + P+N++LY Sbjct: 148 VLYSIRISLTLSCPMNLKLY 167 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 297 ILYKIK*FLLVLIPINIRLY 356 +LY I+ L + P+N++LY Sbjct: 148 VLYSIRISLTLSCPMNLKLY 167 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 3.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 179 YFDKCLLEGFRHYYTVTL 126 Y ++CLLE R Y V L Sbjct: 399 YLERCLLETLRMYPPVPL 416 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 52 NWTLNL*CPSLEFRKYSTSLHQTSS 126 NW L + C S+ + ++++HQ S Sbjct: 3 NWLLLIVCLSIACQDVTSAIHQRKS 27 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 197 CGSFFIYFDKCLL 159 C SF Y+D C+L Sbjct: 84 CSSFRFYWDLCML 96 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 197 CGSFFIYFDKCLL 159 C SF Y+D C+L Sbjct: 84 CSSFRFYWDLCML 96 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 197 CGSFFIYFDKCLL 159 C SF Y+D C+L Sbjct: 84 CSSFRFYWDLCML 96 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.0 bits (42), Expect = 5.5 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -2 Query: 209 ESAGCGSFFIYFDKC 165 ES + YFDKC Sbjct: 454 ESVNIDKLYTYFDKC 468 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.0 bits (42), Expect = 5.5 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -2 Query: 209 ESAGCGSFFIYFDKC 165 ES + YFDKC Sbjct: 454 ESVNIDKLYTYFDKC 468 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 356 LTESLILKQSYTFF 397 LT+SLI Q++ FF Sbjct: 289 LTDSLIAAQAFVFF 302 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,057 Number of Sequences: 438 Number of extensions: 2140 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10503195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -