BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I10 (152 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55855-2|AAA98018.1| 204|Caenorhabditis elegans Proteasome beta... 44 2e-05 Z80215-2|CAB02269.1| 253|Caenorhabditis elegans Hypothetical pr... 25 5.5 U64857-10|AAC25860.1| 265|Caenorhabditis elegans Hypothetical p... 25 5.5 Z99288-2|CAB16547.1| 353|Caenorhabditis elegans Hypothetical pr... 25 9.6 >U55855-2|AAA98018.1| 204|Caenorhabditis elegans Proteasome beta subunit protein 3 protein. Length = 204 Score = 43.6 bits (98), Expect = 2e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 53 MSILAYNGGAVVAMKGQDCVAIATDKRFGIQ 145 MSI++Y GG VVAM G +CV IA+D R G Q Sbjct: 1 MSIMSYTGGTVVAMAGDECVCIASDLRIGEQ 31 >Z80215-2|CAB02269.1| 253|Caenorhabditis elegans Hypothetical protein C36B1.4 protein. Length = 253 Score = 25.4 bits (53), Expect = 5.5 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +2 Query: 32 IFNQDYKMSILAYNGGAVVAMKGQDCVAIATDKR 133 +F +Y + G V ++G+DC+ I +K+ Sbjct: 17 LFQVEYAQEAVK-KGSTAVGVRGKDCIVIGVEKK 49 >U64857-10|AAC25860.1| 265|Caenorhabditis elegans Hypothetical protein C37C3.3 protein. Length = 265 Score = 25.4 bits (53), Expect = 5.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 102 WPFIATTAPPLYASIDIL*S*LNIHCKMFFL 10 +P I + L+ S + S L IHC ++FL Sbjct: 16 YPLIVVSTCALFTSYNFFLSVLRIHCFIYFL 46 >Z99288-2|CAB16547.1| 353|Caenorhabditis elegans Hypothetical protein ZK262.2 protein. Length = 353 Score = 24.6 bits (51), Expect = 9.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 88 CDEGPRLCGYRYGQTLWYPG 147 CD G R GY + ++YPG Sbjct: 247 CDPGSRNGGYHHAIEVFYPG 266 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,582,560 Number of Sequences: 27780 Number of extensions: 48661 Number of successful extensions: 113 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 12,740,198 effective HSP length: 31 effective length of database: 11,879,018 effective search space used: 225701342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -