BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I09 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 25 0.60 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.0 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 24 1.0 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 5.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 5.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.6 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.8 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 25.0 bits (52), Expect = 0.60 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 452 DRSILAIXXXXXXXDSFEYWIFLAQHQENIRDYPC 556 DRS + DS E I L +EN R+Y C Sbjct: 36 DRSNMTFHELKKLRDSSEARIKLINEEENFRNYGC 70 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 546 TTPVDDKESEHREGFTALV 602 T P+DD S+ EGF A++ Sbjct: 150 TNPLDDSISQANEGFCAVI 168 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 546 TTPVDDKESEHREGFTALV 602 T P+DD S+ EGF A++ Sbjct: 145 TNPLDDSISQANEGFCAVI 163 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = -3 Query: 439 YCSARRRAELVKAVRACGDSNKRLYFCGSSVSSSPP 332 YC A++ + ++AV D++ F ++ PP Sbjct: 216 YCYAQKHVKSIRAVTKLPDTSMAKSFVRKVHATKPP 251 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 5.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 390 QARTAFTNSALLLAEQYGFDGIDLSWQLPKRKPKKI 497 ++ T N AL LAE Y G +S KR+ K+ Sbjct: 879 ESSTDSRNPALALAEPYNQRGTVVSPPPTKRRTMKV 914 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 5.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 390 QARTAFTNSALLLAEQYGFDGIDLSWQLPKRKPKKI 497 ++ T N AL LAE Y G +S KR+ K+ Sbjct: 917 ESSTDSRNPALALAEPYNQRGTVVSPPPTKRRTMKV 952 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 511 DLSGTASRKHSGLPLLM 561 D++G +KH PLLM Sbjct: 131 DIAGLRKKKHKVNPLLM 147 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,423 Number of Sequences: 438 Number of extensions: 3116 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -