BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I07 (621 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93382-2|CAB07612.2| 639|Caenorhabditis elegans Hypothetical pr... 29 3.5 >Z93382-2|CAB07612.2| 639|Caenorhabditis elegans Hypothetical protein F45G2.3 protein. Length = 639 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 383 EQRIPPPLVQTGCCTSDLAPRTHLLKYPGLKH 288 E+ PPP+++ T D A +TH + P L H Sbjct: 517 EELKPPPILRKAVSTPDSARKTHKFQSPLLNH 548 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,970,207 Number of Sequences: 27780 Number of extensions: 242002 Number of successful extensions: 411 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1353389824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -