BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_I06 (369 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 24 2.1 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 23 2.8 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.8 bits (49), Expect = 2.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 148 LHSPLKMGCRHSGGGSL 98 LH P M H+GGG++ Sbjct: 573 LHQPFPMLANHAGGGAI 589 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 23.4 bits (48), Expect = 2.8 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 130 FLKVNAEQNSQVTDIIPQRKRANCSITAAATVTP 231 FLK Q+ ++IP+ R C AA P Sbjct: 24 FLKFEVPHCCQMEELIPRPSRTKCQEKAAIDHNP 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 367,209 Number of Sequences: 2352 Number of extensions: 8134 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27944475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -