BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H24 (446 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schi... 29 0.25 SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 28 0.75 SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|c... 27 0.99 SPAC1F7.06 |||ThiJ domain protein|Schizosaccharomyces pombe|chr ... 27 1.3 SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pomb... 25 5.3 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 25 5.3 SPAC17A5.05c |||conserved fungal protein|Schizosaccharomyces pom... 25 5.3 SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizo... 25 7.0 SPCC4B3.16 |tip41||TIP41-like type 2a phosphatase regulator Tip4... 25 7.0 SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce... 25 7.0 SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 7.0 SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 24 9.3 SPCC1827.08c |pof7|SPCC70.11c|F-box protein Pof7|Schizosaccharom... 24 9.3 SPAPB1A10.02 |||chromosome segregation protein |Schizosaccharomy... 24 9.3 >SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schizosaccharomyces pombe|chr 2|||Manual Length = 612 Score = 29.5 bits (63), Expect = 0.25 Identities = 20/69 (28%), Positives = 35/69 (50%) Frame = +2 Query: 131 LDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEI 310 L IF+K +++ ++ FES K+ FH ++ W++ D EEV D+QR + Sbjct: 247 LQIFQKVQLETAKRWTFESEIKRPYFHVKELDEAQLVNWRKYLDF--EEVEGDFQRICHL 304 Query: 311 VARHVLGAA 337 R ++ A Sbjct: 305 YERCLITCA 313 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 27.9 bits (59), Expect = 0.75 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 125 RFLDIFEKTFVQSLQKGKFESYG-KKID-FHDEKA 223 +FL+I+ +T + L G E G KK++ +HD KA Sbjct: 606 QFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKA 640 >SPAC5D6.02c |mug165||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 27.5 bits (58), Expect = 0.99 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = +3 Query: 144 KRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSL-- 317 K+L + K + + + +T+ R+ L +T + +C K+ + I DL+ SL Sbjct: 198 KQLDHFFSYKVTTVHKSYQRFATLLRRHLLDKTAKRYHDLCEKRPYKYITTDLLSPSLTC 257 Query: 318 -AMCSVQHLNHSTSTPSCPVRLTFT 389 A +Q + TS+ S PV L T Sbjct: 258 FASDILQTVPEYTSSQSSPVLLPAT 282 >SPAC1F7.06 |||ThiJ domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 251 Score = 27.1 bits (57), Expect = 1.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 44 LMTSYYFPFAQRPDNYNLHSVKNYEAIRFLD 136 L+ SYY PF DN ++ V YEA + + Sbjct: 20 LLNSYYGPFYDDGDNTGVNVVDLYEAFKVFE 50 >SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 424 Score = 25.0 bits (52), Expect = 5.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 143 EKTFVQSLQKGKFESYGKKIDFHDEKAIN 229 EKT V+S+ K + + G DFH E A N Sbjct: 12 EKTHVESIVKFEDSNRGTITDFHIETANN 40 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 25.0 bits (52), Expect = 5.3 Identities = 17/71 (23%), Positives = 26/71 (36%) Frame = +3 Query: 168 RKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNH 347 RK R+ ++ + + L + IC Q I L + C L H Sbjct: 1063 RKIAHFESRRRYLTNLYEHIVLKAESHQICIICRDIIKQGFITTCGHLYCSFCLEAWLKH 1122 Query: 348 STSTPSCPVRL 380 S+S P C +L Sbjct: 1123 SSSCPMCKTKL 1133 >SPAC17A5.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 247 Score = 25.0 bits (52), Expect = 5.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 305 EIVARHVLGAAPKPFDKHTFMPSALDFYQNRTSRPCI 415 EI R + P PF+ P L+ Y NR +PC+ Sbjct: 104 EISIRSIPPELP-PFELIATDPFTLEAYTNRIGKPCL 139 >SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 24.6 bits (51), Expect = 7.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 302 YEIVARHVLGAAPKPFDKHTFMPSALDFY 388 Y +ARH L + FD HTF + FY Sbjct: 183 YARLARHGLSEPSEMFDIHTFRENPEIFY 211 >SPCC4B3.16 |tip41||TIP41-like type 2a phosphatase regulator Tip41|Schizosaccharomyces pombe|chr 3|||Manual Length = 252 Score = 24.6 bits (51), Expect = 7.0 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 215 EKAINFVGNYWQENADLYEEEVTKDYQRSYEIVARHVLG 331 +K +N N W L+E+E+ + + +++ AR V G Sbjct: 131 QKILNAGQNLWFNEIILFEDELADNGKSMFDVRARVVQG 169 >SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 24.6 bits (51), Expect = 7.0 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +2 Query: 92 NLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYE 271 NL+S + Y + + +++ S GK+ Y ++ + D + N G Y + N Y Sbjct: 161 NLNSQEFYGRVLNVQKAKRSRPHSPTPGKYMGYDRRRNSRDFPSNNKDGGYRRNN---YR 217 Query: 272 EEVTKDYQRSY 304 + + Y+ SY Sbjct: 218 DRDSNRYRNSY 228 >SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 24.6 bits (51), Expect = 7.0 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 222 QLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNHSTSTP-SCPVRL 380 +L S TI P+C++ K + +N L+L+ + L TS P CP++L Sbjct: 228 ELNASVTISG-IPVCIRSKEKMFLNPDCALTLSFICI-FLAQYTSIPLPCPLQL 279 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 24.2 bits (50), Expect = 9.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 125 RFLDIFEKTFVQSLQKGKFES 187 RF+DIFE+TF S + KF S Sbjct: 528 RFIDIFEQTF-SSKKNAKFIS 547 >SPCC1827.08c |pof7|SPCC70.11c|F-box protein Pof7|Schizosaccharomyces pombe|chr 3|||Manual Length = 361 Score = 24.2 bits (50), Expect = 9.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +2 Query: 245 WQENADLYEEEVTKDYQRSYE 307 WQ++ EEE+ + YQ+S++ Sbjct: 170 WQQSIKSIEEELVEKYQQSWK 190 >SPAPB1A10.02 |||chromosome segregation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 336 Score = 24.2 bits (50), Expect = 9.3 Identities = 20/80 (25%), Positives = 38/80 (47%) Frame = +3 Query: 168 RKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNH 347 RK +++ + +K TL++ G T +K K L +S + S + N Sbjct: 191 RKVDASALEKKSCLLPNSSGTLTDQRGLDT---IKHKSIEQNEILHVISDTLSSPRRRNP 247 Query: 348 STSTPSCPVRLTFTKTALRD 407 S+P P+R +F+K+ +R+ Sbjct: 248 LLSSPKTPLRRSFSKSKVRN 267 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,927,129 Number of Sequences: 5004 Number of extensions: 39957 Number of successful extensions: 146 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 164204010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -