BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H23 (556 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 266 1e-73 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 3.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 3.6 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 4.8 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 6.3 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 6.3 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 8.4 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 266 bits (652), Expect = 1e-73 Identities = 133/148 (89%), Positives = 141/148 (95%) Frame = +2 Query: 104 ENPIYGPFFGVMGAASAIIFSSLGAAYGTAKSGTGIAAMAVMRPEQIMKSIIPVVMAGII 283 ++PIY PFFGVMGAASAIIFS+LGAAYGTAKSGTGIAAM+VMRPE IMKSIIPVVMAGII Sbjct: 5 DHPIYAPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 64 Query: 284 AIYGLVVAVLIAGSLDQPSNNYTLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTA 463 AIYGLVVAVLIAG L++P YTL+KGF+HLGAGLAVGFSGLAAGFAIGIVGDAGVRGTA Sbjct: 65 AIYGLVVAVLIAGGLEEP-KGYTLFKGFVHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTA 123 Query: 464 QQPRLFVGMILILIFAEVXGLYGLIVAI 547 QQPRLFVGMILILIFAEV GLYGLIVAI Sbjct: 124 QQPRLFVGMILILIFAEVLGLYGLIVAI 151 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 24 VSWSECVQIVIRVFGTCKYSHIQ 92 +SW E +QI + V +Y H Q Sbjct: 694 LSWLERIQIALDVLEGIRYLHSQ 716 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 24 VSWSECVQIVIRVFGTCKYSHIQ 92 +SW E +QI + V +Y H Q Sbjct: 732 LSWLERIQIALDVLEGIRYLHSQ 754 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 4.8 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 Query: 232 PHHRHGGNT 206 PHH+HG +T Sbjct: 334 PHHQHGNHT 342 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 6.3 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 266 VMAGIIAIYGLVVAVLIAGSLDQ 334 +++G+I GL++ VLI GS+ + Sbjct: 413 IVSGLIT--GLIMRVLICGSISE 433 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 196 LGCAICSTKGAEDDGRRRPHNS 131 L C + +T+GA+D R P ++ Sbjct: 308 LHCNMENTEGADDASERNPRSA 329 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 316 NQDSYDQSVDGNDTRHDNGN 257 NQ++ +Q+ D + NGN Sbjct: 439 NQNANNQNADNQNANKQNGN 458 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,292 Number of Sequences: 438 Number of extensions: 4838 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -