Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_H22
         (261 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.          21   1.9  
AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.              19   7.6  
AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta...    19   7.6  

>AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.
          Length = 148

 Score = 21.4 bits (43), Expect = 1.9
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = -3

Query: 214 LLPAPQNSAARTHQTLSARIVGSHPLSLSFCPSRKYGS 101
           L+  P  + +  H  + A  V  + LSLS  P   +GS
Sbjct: 2   LVARPMQALSIRHAVILASFVWIYALSLSLPPLFGWGS 39


>AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.
          Length = 145

 Score = 19.4 bits (38), Expect = 7.6
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +1

Query: 160 VHLVSDEYEQL 192
           VH+  DEY+++
Sbjct: 43  VHITKDEYDEI 53


>AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta
           protein precursor protein.
          Length = 145

 Score = 19.4 bits (38), Expect = 7.6
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +1

Query: 160 VHLVSDEYEQL 192
           VH+  DEY+++
Sbjct: 43  VHITKDEYDEI 53


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,624
Number of Sequences: 438
Number of extensions: 1476
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 48
effective length of database: 125,319
effective search space used:  4762122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)