BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0001_H22
(261 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 21 1.9
AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 19 7.6
AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 19 7.6
>AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein.
Length = 148
Score = 21.4 bits (43), Expect = 1.9
Identities = 12/38 (31%), Positives = 18/38 (47%)
Frame = -3
Query: 214 LLPAPQNSAARTHQTLSARIVGSHPLSLSFCPSRKYGS 101
L+ P + + H + A V + LSLS P +GS
Sbjct: 2 LVARPMQALSIRHAVILASFVWIYALSLSLPPLFGWGS 39
>AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein.
Length = 145
Score = 19.4 bits (38), Expect = 7.6
Identities = 5/11 (45%), Positives = 9/11 (81%)
Frame = +1
Query: 160 VHLVSDEYEQL 192
VH+ DEY+++
Sbjct: 43 VHITKDEYDEI 53
>AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta
protein precursor protein.
Length = 145
Score = 19.4 bits (38), Expect = 7.6
Identities = 5/11 (45%), Positives = 9/11 (81%)
Frame = +1
Query: 160 VHLVSDEYEQL 192
VH+ DEY+++
Sbjct: 43 VHITKDEYDEI 53
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,624
Number of Sequences: 438
Number of extensions: 1476
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 48
effective length of database: 125,319
effective search space used: 4762122
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)
- SilkBase 1999-2023 -