BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H21 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19110.1 68414.m02377 inter-alpha-trypsin inhibitor heavy cha... 49 2e-06 At5g60710.1 68418.m07618 zinc finger (C3HC4-type RING finger) fa... 43 1e-04 At1g08050.1 68414.m00879 zinc finger (C3HC4-type RING finger) fa... 42 2e-04 At2g38970.1 68415.m04789 zinc finger (C3HC4-type RING finger) fa... 40 8e-04 At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger) fa... 40 0.001 At3g54780.2 68416.m06062 zinc finger (C3HC4-type RING finger) fa... 40 0.001 At3g54780.1 68416.m06061 zinc finger (C3HC4-type RING finger) fa... 40 0.001 At1g72500.1 68414.m08383 inter-alpha-trypsin inhibitor heavy cha... 38 0.006 At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chlor... 31 0.51 At5g63620.1 68418.m07987 oxidoreductase, zinc-binding dehydrogen... 29 2.7 At5g63620.2 68418.m07988 oxidoreductase, zinc-binding dehydrogen... 28 4.7 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 28 4.7 At5g65950.1 68418.m08302 expressed protein 27 6.2 At5g48320.1 68418.m05969 DC1 domain-containing protein contains ... 27 6.2 At4g21210.1 68417.m03066 expressed protein contains Pfam domain ... 27 6.2 At4g18490.1 68417.m02742 hypothetical protein 27 6.2 At4g14030.1 68417.m02168 selenium-binding protein, putative cont... 27 6.2 At4g18700.1 68417.m02765 CBL-interacting protein kinase 12 (CIPK... 27 8.3 At3g20290.1 68416.m02571 calcium-binding EF hand family protein ... 27 8.3 >At1g19110.1 68414.m02377 inter-alpha-trypsin inhibitor heavy chain-related similar to SP|Q61704 Inter-alpha-trypsin inhibitor heavy chain H3 precursor {Mus musculus}; contains Pfam profile PF00092: von Willebrand factor type A domain Length = 754 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 252 VVFV+D S SM+G+ +E +K A+ T L++L+PGD F+II F + Sbjct: 329 VVFVVDISKSMTGKPLEDVKNAISTALSKLDPGDSFNIITFSN 371 >At5g60710.1 68418.m07618 zinc finger (C3HC4-type RING finger) family protein low similarity to SP|P97280 Inter-alpha-trypsin inhibitor heavy chain H3 precursor {Mesocricetus auratus}; contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 704 Score = 43.2 bits (97), Expect = 1e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 252 +V VLD SGSM+G K+ LK AM ++ L P D S+I F S Sbjct: 253 LVTVLDVSGSMAGTKLALLKRAMGFVIQNLGPFDRLSVISFSS 295 >At1g08050.1 68414.m00879 zinc finger (C3HC4-type RING finger) family protein low similarity to SP|P79263 Inter-alpha-trypsin inhibitor heavy chain H4 precursor {Sus scrofa}; contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 641 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/44 (45%), Positives = 27/44 (61%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESI 255 ++ VLD SGSM G KME +K AM ++ L D S+I F S+ Sbjct: 205 LITVLDVSGSMDGVKMELMKNAMSFVIQNLGETDRLSVISFSSM 248 >At2g38970.1 68415.m04789 zinc finger (C3HC4-type RING finger) family protein very low similarity to SP|P97280 Inter-alpha-trypsin inhibitor heavy chain H3 precursor {Mesocricetus auratus}; contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 692 Score = 40.3 bits (90), Expect = 8e-04 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES----IITVHELSEADKE 291 +V VLD SGSM+G K+ LK AM ++ L D S+I F S + + ++S+A ++ Sbjct: 254 LVTVLDISGSMAGTKLALLKRAMGFVIQNLGSNDRLSVIAFSSTARRLFPLTKMSDAGRQ 313 Query: 292 K 294 + Sbjct: 314 R 314 >At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 683 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 252 +V VLD SG SG K+E LK+ M +L+ L D SII F S Sbjct: 303 LVAVLDVSGRNSGGKLEMLKQTMRIVLSNLREMDRLSIIAFSS 345 >At3g54780.2 68416.m06062 zinc finger (C3HC4-type RING finger) family protein low similarity to SP|P79263 Inter-alpha-trypsin inhibitor heavy chain H4 precursor {Sus scrofa}; contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 676 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 252 +V VLD SGSM G K+ LK AM ++ L D S+I F S Sbjct: 245 LVTVLDISGSMGGTKLALLKRAMGFVIQNLGSSDRLSVIAFSS 287 >At3g54780.1 68416.m06061 zinc finger (C3HC4-type RING finger) family protein low similarity to SP|P79263 Inter-alpha-trypsin inhibitor heavy chain H4 precursor {Sus scrofa}; contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 675 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 252 +V VLD SGSM G K+ LK AM ++ L D S+I F S Sbjct: 244 LVTVLDISGSMGGTKLALLKRAMGFVIQNLGSSDRLSVIAFSS 286 >At1g72500.1 68414.m08383 inter-alpha-trypsin inhibitor heavy chain-related low similarity to Inter-alpha-inhibitor H4 heavy chain [Rattus norvegicus] GI:2292988; contains Pfam profile PF00092: von Willebrand factor type A domain Length = 758 Score = 37.5 bits (83), Expect = 0.006 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 258 VVFV+D S SM + +E +K+A+ L +L D F+II F I Sbjct: 329 VVFVIDISASMKWKPLEDVKKALLECLAKLQAEDVFNIIAFNDEI 373 >At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chloroplast, putative / Mg-protoporphyrin IX chelatase, putative (CHLD) similar to Mg-chelatase SP|O24133 from Nicotiana tabacum, GB:AF014399 GI:2318116 from [Pisum sativum] Length = 760 Score = 31.1 bits (67), Expect = 0.51 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 124 VVFVLDTSGSMSGRKMEQLKEAMYTILNE-LNPGDYFSIIDF 246 V+FV+D SGSM+ +M+ K A +L E D SII F Sbjct: 559 VIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPF 600 >At5g63620.1 68418.m07987 oxidoreductase, zinc-binding dehydrogenase family protein contains PFAM zinc-binding dehydrogenase domain PF00107 Length = 427 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 382 KAKII-ISRLESIGGTDINTALTVAVDLINKYAGGNARQDV 501 KA +I +S+ S+G DIN + + +I Y GG ARQD+ Sbjct: 340 KAVMIGLSQAGSVGEIDINRLVRRKIKVIGSY-GGRARQDL 379 >At5g63620.2 68418.m07988 oxidoreductase, zinc-binding dehydrogenase family protein contains PFAM zinc-binding dehydrogenase domain PF00107 Length = 427 Score = 27.9 bits (59), Expect = 4.7 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 382 KAKII-ISRLESIGGTDINTALTVAVDLINKYAGGNARQDV 501 KA +I +S+ S+G DIN + V +I Y GG ARQD+ Sbjct: 340 KAVMIGLSQAGSVGEIDINRLVRRKVWVIGSY-GGRARQDL 379 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 154 MSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITVHELSEADK 288 ++G ++ MY +LN L P + S+ FE H+L+ A+K Sbjct: 842 LTGTPLQNNIGEMYNLLNFLQPSSFPSLSSFEE--RFHDLTSAEK 884 >At5g65950.1 68418.m08302 expressed protein Length = 865 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/73 (20%), Positives = 35/73 (47%) Frame = +1 Query: 172 EQLKEAMYTILNELNPGDYFSIIDFESIITVHELSEADKEKTRYKYFYYNEIQPKLDLVA 351 +++ + +I + G + +++ IT+H ++ D+E TRY +Q L ++A Sbjct: 70 QEIDSSSASITPSVYVGQFAQLLEKGEAITLHSIT--DEEYTRYTISEAKRVQDSLQIIA 127 Query: 352 PYQATPENIEKAK 390 + + E+ K Sbjct: 128 WLKRSYESFTNLK 140 >At5g48320.1 68418.m05969 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 977 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 214 NPGDYFSIIDFESIITVHELSEADKEKTRYKYFYYNEIQPKLDLVAPYQATPE 372 N G Y +I E + + L E D Y Y +E+ LD+ +A P+ Sbjct: 309 NSGTYSNIEHLEMDLNIEHL-EMDSNSDTYVYIKLSELDSDLDIEFDLEADPD 360 >At4g21210.1 68417.m03066 expressed protein contains Pfam domain PF03618: Domain of unknown function (DUF299) Length = 403 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 361 ATPENIEKAKIIISRLESIGGTDINTAL 444 A PEN+EKA I++ + G T ++T L Sbjct: 255 ALPENLEKADIVLVGVSRTGKTPLSTYL 282 >At4g18490.1 68417.m02742 hypothetical protein Length = 594 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/74 (29%), Positives = 33/74 (44%) Frame = +1 Query: 247 ESIITVHELSEADKEKTRYKYFYYNEIQPKLDLVAPYQATPENIEKAKIIISRLESIGGT 426 ES I E KE + K Y N L++ P +NIEKA+ LE Sbjct: 486 ESRIDTKTTKEPVKESPQTKSHYQNINMANLEI--PITENADNIEKAEAYTKELE----- 538 Query: 427 DINTALTVAVDLIN 468 ++N AL ++++N Sbjct: 539 NVNRALFSIMNILN 552 >At4g14030.1 68417.m02168 selenium-binding protein, putative contains Pfam profile PF05694: 56kDa selenium binding protein (SBP56); identical to Putative selenium-binding protein (Swiss-Prot:O23264) [Arabidopsis thaliana]; similar to selenium binding protein (GI:15485232) [Arabidopsis thaliana]; identical to cDNA from partial mRNA for selenium binding protein (sbp gene) GI:15485231 Length = 490 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 10 GQFVVQYDVDRPKDGQILVNDGYFVHF-FAPDLPPL 114 G ++Q DVD K G + +N +FV F PD P L Sbjct: 439 GSHIIQIDVDTEKGG-LTINPDFFVDFGDEPDGPSL 473 >At4g18700.1 68417.m02765 CBL-interacting protein kinase 12 (CIPK12) identical to CBL-interacting protein kinase 12 [Arabidopsis thaliana] gi|13249123|gb|AAK16687; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 12 (CIPK12) GI:13249122 Length = 489 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 235 IIDFESIITVHELSEADKEKTRYKYFYYNEIQPKL 339 I + + V E+ + +KT Y+ F NE++PKL Sbjct: 418 IFELTPSLVVVEVKKKGGDKTEYEDFCNNELKPKL 452 >At3g20290.1 68416.m02571 calcium-binding EF hand family protein similar to EH-domain containing protein 1 from {Mus musculus} SP|Q9WVK4 and {Homo sapiens} SP|Q9H4M9, receptor-mediated endocytosis 1 from [Caenorhabditis elegans] GI:13487775, GI:13487777, GI:13487779; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 545 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +1 Query: 22 VQYDVDRPKDGQILVNDGYFVHFFAPDLP-PLNKYVVFVLDTSGSMSGRKMEQLKEAMYT 198 V D P G + F +P PL ++V FV DT G +SG K + +T Sbjct: 253 VAVQADMPFSGLTTFGTAFLSKFECSQMPHPLLEHVTFV-DTPGVLSGEKQRTQRAYDFT 311 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,823,957 Number of Sequences: 28952 Number of extensions: 241785 Number of successful extensions: 668 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -