BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H19 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 24 1.2 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 24 1.2 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 3.7 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 4.9 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 252 LLLFCNYFFLILFR 211 LL+F YFF ILFR Sbjct: 80 LLVFLTYFFNILFR 93 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 252 LLLFCNYFFLILFR 211 LL+F YFF ILFR Sbjct: 76 LLVFLTYFFNILFR 89 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/50 (20%), Positives = 25/50 (50%) Frame = -2 Query: 285 IYLRDVIIFFSLLLFCNYFFLILFRIPDVKYNVYVN*ESDQSSRKRYVNM 136 +Y+ ++IF + FC + +I +I D+ E Q+ +++++ Sbjct: 176 VYVSYLLIFVQQIPFCFFVRVIRLKIEDLNGAFRAGLERVQNGENQWISV 225 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 332 KRLSYRILDVITHLHIFLIKLNKT 403 K L+ ILD ++ H+FL++ +T Sbjct: 179 KELNRVILDNMSRNHLFLVRRTET 202 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,635 Number of Sequences: 336 Number of extensions: 2029 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -