BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H19 (643 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92812-8|CAB07275.1| 337|Caenorhabditis elegans Hypothetical pr... 49 2e-06 AC024881-4|AAK71412.2| 314|Caenorhabditis elegans Serpentine re... 31 0.53 U58754-8|AAK72082.1| 325|Caenorhabditis elegans Serpentine rece... 29 2.1 >Z92812-8|CAB07275.1| 337|Caenorhabditis elegans Hypothetical protein T03E6.7 protein. Length = 337 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = +3 Query: 9 GYIKMARNRNNHCGIASAASYPLV 80 GYI++ARNRNNHCG+A+ ASYPLV Sbjct: 314 GYIRIARNRNNHCGVATKASYPLV 337 >AC024881-4|AAK71412.2| 314|Caenorhabditis elegans Serpentine receptor, class sx protein5 protein. Length = 314 Score = 31.5 bits (68), Expect = 0.53 Identities = 9/32 (28%), Positives = 22/32 (68%) Frame = -2 Query: 291 TFIYLRDVIIFFSLLLFCNYFFLILFRIPDVK 196 T I++ ++FF L+ + +F+++++R PD + Sbjct: 240 TLIFMMSNLVFFVLISYSQFFYIVIWRSPDYR 271 >U58754-8|AAK72082.1| 325|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 13 protein. Length = 325 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/79 (25%), Positives = 35/79 (44%) Frame = -2 Query: 483 SKLKITYKDKGICFHF*NSVLII*DFLVLFNFIKNICKCVITSSIRYDSLFKI*QLTLGA 304 S L + Y G C HF + + L+L F ++ +++ S R L+K Sbjct: 69 SDLSLAYISNGFCHHFGPTTCYVGYSLMLHCFSHSLWSLLLSFSYRCYILYKPAPTRPVL 128 Query: 303 VILLTFIYLRDVIIFFSLL 247 V+++ IY ++ F S L Sbjct: 129 VLIIFLIYTPSLLQFVSFL 147 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,918,376 Number of Sequences: 27780 Number of extensions: 161824 Number of successful extensions: 337 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -