BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H18 (644 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 32 0.018 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 29 0.17 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 26 0.89 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 1.6 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 25 1.6 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 3.6 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 24 4.7 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 31.9 bits (69), Expect = 0.018 Identities = 30/111 (27%), Positives = 49/111 (44%), Gaps = 10/111 (9%) Frame = +2 Query: 68 VLFACVALAHGAMVRRDAPNTILQDLEKHA----QDFQKTISEQF------NAIVNSKNT 217 VL AL A RR N D E A DF ++ ++ NA+++ + Sbjct: 12 VLCCVFALTIAATPRRFLQNRFTVDYEPFAGPWNDDFDWSVIKEVLHKAPGNAVISPLSV 71 Query: 218 ESLNKALKEGSDSMVQQVSELSNSLQGALTDANGKAKEVLQQARQNLERTV 370 ++L L EGS S + EL +L G + A K ++ L Q +Q ++ + Sbjct: 72 KALLALLYEGSASRSETERELQQALSGGNSQAVPKLQDDLLQYKQQQQQNL 122 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 28.7 bits (61), Expect = 0.17 Identities = 18/72 (25%), Positives = 25/72 (34%) Frame = +1 Query: 328 GSAPTSSPELGAHSRGSPQGAPRRRETSHRITREAANRHPEHTKGEPEPGEGSRRQHGSD 507 G A +S G + GSP G + H AA H H ++QH S Sbjct: 684 GGAGSSGGSGGGLASGSPYGGGGHHLSHHHGGAAAATGHHHHQHHAAPHHHSLQQQHASS 743 Query: 508 LTETGAKTESGI 543 + SG+ Sbjct: 744 AFNSAGDARSGV 755 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.2 bits (55), Expect = 0.89 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = +2 Query: 275 ELSNSLQGALTDANGKAKEVLQQARQNLERTVEDLRKAHPDVE 403 E + D K +E +Q + +N+ +ED+ HP ++ Sbjct: 403 EFLRFISSTAPDGKAKYQEWVQDSCRNIVHVLEDIPSCHPPID 445 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 25.4 bits (53), Expect = 1.6 Identities = 23/85 (27%), Positives = 39/85 (45%) Frame = +2 Query: 182 EQFNAIVNSKNTESLNKALKEGSDSMVQQVSELSNSLQGALTDANGKAKEVLQQARQNLE 361 E+ + +N K + K+G S E +QG L N + K+ + + QN Sbjct: 359 EECSRELNLKEQKRKELYAKQGRGSQFSSKEERDKWIQGELKSLNKQIKDKI--SHQN-- 414 Query: 362 RTVEDLRKAHPDVEKQATALHEKLQ 436 + +DL+K D+ KQ L +K+Q Sbjct: 415 KLQDDLKK---DIAKQG-ELEKKIQ 435 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 383 KAHPDVEKQATALHEKLQTAIQ-NTLKESQNL 475 KAHPD+++ L K T I TL+ QN+ Sbjct: 350 KAHPDLQQSVDDLMAKFNTPIDGKTLQYFQNI 381 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 3.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 354 FWRACWSTSLALPFASVNAPCRLLDNSETCCTM 256 FWR CW L +++ RL + S CTM Sbjct: 758 FWRMCWE----LKSSTIVMMTRLEERSRIKCTM 786 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 476 PGSGSPLVCSGWRFAASRVMRWLV 405 P P +C G RFA ++V R +V Sbjct: 58 PFGDGPRMCLGMRFAVTQVRRAIV 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,265 Number of Sequences: 2352 Number of extensions: 10904 Number of successful extensions: 32 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -