BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H15 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 32 0.46 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 3.2 SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) 29 3.2 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 9.8 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 31.9 bits (69), Expect = 0.46 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = +1 Query: 409 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*S 582 L L+L ++ HL +ST T S LT T T ++++ T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTL-TYSTLTHSTLTHSTLTHSTLTHS 110 Query: 583 LILKRNFISSALNH 624 + S L H Sbjct: 111 TLTHSTITHSTLTH 124 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 4/78 (5%) Frame = +1 Query: 412 MKLSLAMCSVQHLNHSTSTPSCPVRLTFTKP---HFETLH-SISYXTGLWVTLTHSSIT* 579 + L+ + + L H T T S LT T H H ++++ T + TLTHS++T Sbjct: 40 LNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTH 99 Query: 580 SLILKRNFISSALNHDVV 633 S + S L H + Sbjct: 100 STLTHSTLTHSTLTHSTI 117 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 424 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 516 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 30.3 bits (65), Expect = 1.4 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = +3 Query: 138 TGYYPLMT-SYYFPF--AQRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKK 308 T Y P T S Y Q+P+N++LH +A+ T L GKF+S G+ Sbjct: 4715 TSYQPAATDSLYISSQSTQKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRT 4770 Query: 309 IDFHD 323 D H+ Sbjct: 4771 RDVHE 4775 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 330 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 199 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +3 Query: 273 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 404 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) Length = 869 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +1 Query: 13 LSIAVAKYITISTNN*QHVITS-SVLQTAWVPYLNSLGTRLLR 138 + +A AKYI +S + + VI + S + +PY NS+ T +LR Sbjct: 165 IQLAEAKYINVSLHFLEQVIVALSEKSRSHIPYRNSMMTSVLR 207 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 288 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 428 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,029,878 Number of Sequences: 59808 Number of extensions: 418056 Number of successful extensions: 1184 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1175 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -