BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H14 (565 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 0.78 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 4.2 AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 22 4.2 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.2 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.2 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 4.2 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 9.6 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 21 9.6 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 24.2 bits (50), Expect = 0.78 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 498 SFINHAINTRYIXNYINHITAEF 430 S++NH N NY+ HI+ F Sbjct: 318 SWVNHLSNIEDCLNYVPHISTGF 340 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 58 LTVTKAYRVNSNIKFEVFIHKVDGLNDDY 144 L + + YRV + + F H +G N+ Y Sbjct: 586 LLLQRGYRVEYSAASDAFTHCPEGFNEFY 614 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 58 LTVTKAYRVNSNIKFEVFIHKVDGLNDDY 144 L + + YRV + + F H +G N+ Y Sbjct: 819 LLLQRGYRVEYSAASDAFTHCPEGFNEFY 847 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 58 LTVTKAYRVNSNIKFEVFIHKVDGLNDDY 144 L + + YRV + + F H +G N+ Y Sbjct: 819 LLLQRGYRVEYSAASDAFTHCPEGFNEFY 847 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 58 LTVTKAYRVNSNIKFEVFIHKVDGLNDDY 144 L + + YRV + + + H +G N+ Y Sbjct: 846 LLLQRGYRVEYSAASDAYTHAPEGFNEFY 874 Score = 20.6 bits (41), Expect = 9.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 350 IPELDIRIFKRFSNVGSCGINF*TTLLN 267 I LD+ KRF+ + + G N T +L+ Sbjct: 1431 IGTLDVAFKKRFAKLNANGTNAGTPVLS 1458 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 58 LTVTKAYRVNSNIKFEVFIHKVDGLNDDY 144 L + + YRV + + + H +G N+ Y Sbjct: 846 LLLQRGYRVEYSAASDAYTHAPEGFNEFY 874 Score = 20.6 bits (41), Expect = 9.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 350 IPELDIRIFKRFSNVGSCGINF*TTLLN 267 I LD+ KRF+ + + G N T +L+ Sbjct: 1431 IGTLDVAFKKRFAKLNANGTNAGTPVLS 1458 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 58 LTVTKAYRVNSNIKFEVFIHKVDGLNDDY 144 L + + YRV + + + H +G N+ Y Sbjct: 846 LLLQRGYRVEYSAASDAYTHAPEGFNEFY 874 Score = 20.6 bits (41), Expect = 9.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 350 IPELDIRIFKRFSNVGSCGINF*TTLLN 267 I LD+ KRF+ + + G N T +L+ Sbjct: 1431 IGTLDVAFKKRFAKLNANGTNAGTPVLS 1458 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 58 LTVTKAYRVNSNIKFEVFIHKVDGLNDDY 144 L + + YRV + + + H +G N+ Y Sbjct: 846 LLLQRGYRVEYSAASDAYTHAPEGFNEFY 874 Score = 20.6 bits (41), Expect = 9.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 350 IPELDIRIFKRFSNVGSCGINF*TTLLN 267 I LD+ KRF+ + + G N T +L+ Sbjct: 1431 IGTLDVAFKKRFAKLNANGTNAGTPVLS 1458 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = +1 Query: 370 DVVSKIYIATDSSPVDMQSYELCCDMIDVVXDISCIYGMVDETE 501 D+ + + D+ P D Q +C +D+ + +VDE + Sbjct: 546 DIDPQQFCNGDNRPADCQQNCMCTHKVDIPLNAIVEIVLVDEVQ 589 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 499 QFHQPCHKYKIYLXLHQSY 443 Q +QP H +++ HQ+Y Sbjct: 43 QNNQPVHDEHLFIVTHQAY 61 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 499 QFHQPCHKYKIYLXLHQSY 443 Q +QP H +++ HQ+Y Sbjct: 43 QNNQPVHDEHLFIVTHQAY 61 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 499 QFHQPCHKYKIYLXLHQSY 443 Q +QP H +++ HQ+Y Sbjct: 43 QNNQPVHDEHLFIVTHQAY 61 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 227 FTSPLYMITLYLKHLVKL 280 FTS L + LYLKH +++ Sbjct: 258 FTSTLEIDNLYLKHKLEI 275 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 472 KIYLXLHQSYHSRVHNFACQ 413 K L H HS V+ ++C+ Sbjct: 271 KSMLNSHMKSHSNVYRYSCR 290 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 472 KIYLXLHQSYHSRVHNFACQ 413 K L H HS V+ ++C+ Sbjct: 29 KSMLNSHMKSHSNVYRYSCR 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,015 Number of Sequences: 336 Number of extensions: 2382 Number of successful extensions: 19 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -