BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H14 (565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 3.0 AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 23 6.9 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 24.2 bits (50), Expect = 3.0 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 410 GELSVAI*IFDTTSNRNAFSIPELDIRIFKRFSN-VGSC 297 GEL+ A+ D T R+ P LD+ I R ++ +G+C Sbjct: 316 GELNDALKRMDVTVVRHPDGNPHLDLAILGRANHFIGNC 354 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +2 Query: 116 IRLMDSMMIIKWNHREIFITELLMILQKRDW 208 +RLMD ++ + E+F+T+L+ + +D+ Sbjct: 71 LRLMDEKGVVLKDKLEVFLTKLMDADKAKDY 101 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 514,514 Number of Sequences: 2352 Number of extensions: 9674 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -