BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H13 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.9 SB_2820| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 717 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 224 RSVGKKVDASPETPEQADQPQPEIPELVDPIHYPY 328 + + ++V PE+ +D P P+IP +V P H P+ Sbjct: 97 KGIARRVSNVPESDPASDPPSPDIPVVV-PDHRPF 130 >SB_2820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1140 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 110 QFLPERPGYVPVYIRSGDTPLEEINPYLAEAFHAIPAGRSVGKKVDASPETPEQAD 277 +F+P RPG V++R P+E +P+L I G +VD + ET A+ Sbjct: 842 KFIPNRPGTYKVHVRCDGEPVEN-SPFL------IKVGEPEPVQVDLTLETTSGAE 890 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,626,117 Number of Sequences: 59808 Number of extensions: 297991 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -