BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H13 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family... 29 3.6 At5g16840.1 68418.m01973 RNA recognition motif (RRM)-containing ... 28 6.2 >At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family protein Length = 477 Score = 28.7 bits (61), Expect = 3.6 Identities = 20/77 (25%), Positives = 25/77 (32%) Frame = +2 Query: 92 EARPKWQFLPERPGYVPVYIRSGDTPLEEINPYLAEAFHAIPAGRSVGKKVDASPETPEQ 271 E P+ P G+ P + +PL NP P G S A P Sbjct: 346 ELAPEPSLSPPTKGFAPASAPTKHSPLPPRNPPCPYEQRR-PKGNSALNHHTAPPTPAPH 404 Query: 272 ADQPQPEIPELVDPIHY 322 QP P P P H+ Sbjct: 405 RSQPHPPAPNPAPPRHH 421 >At5g16840.1 68418.m01973 RNA recognition motif (RRM)-containing protein predicted proteins - Arabidopsis thaliana Length = 259 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 221 GRSVGKKVDASPETPEQADQPQPEIPELVDPIH 319 G+ +KV+A E P Q Q Q ++PE PIH Sbjct: 222 GQKTKEKVEA--EQPSQPAQSQQQLPEGYSPIH 252 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,490,363 Number of Sequences: 28952 Number of extensions: 205839 Number of successful extensions: 536 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -