BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H11 (558 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18694| Best HMM Match : SNF7 (HMM E-Value=0.46) 29 1.9 SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) 29 2.6 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 29 2.6 SB_16232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_29473| Best HMM Match : CASP_C (HMM E-Value=6.5) 29 3.4 SB_12423| Best HMM Match : Glypican (HMM E-Value=1.00053e-42) 29 3.4 SB_56560| Best HMM Match : GBP_C (HMM E-Value=0.065) 28 5.9 SB_8982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) 28 5.9 SB_38073| Best HMM Match : ABC_tran (HMM E-Value=1.2e-17) 28 5.9 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 28 5.9 >SB_18694| Best HMM Match : SNF7 (HMM E-Value=0.46) Length = 238 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 148 LESIEKRKAISSHQDYQHGRLYRRYH*ALLM 240 + S EKR+++S Q + RL ++YH LLM Sbjct: 58 IASEEKRRSVSEDQKKELSRLLKKYHKTLLM 88 >SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) Length = 679 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 148 LESIEKRKAISSHQDYQHGRLYRRYH*ALLM 240 + S EKR+++S Q + RL ++YH LLM Sbjct: 498 IASEEKRRSVSEDQKKELSRLLKKYHKKLLM 528 >SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) Length = 286 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = -3 Query: 385 IFKSVNIAPESFKTPPSFSPISFKILKYFLLKHEC---GW 275 +++ +IAP+S+ P +F+P++ + Y L+ H GW Sbjct: 32 VYRRASIAPQSYGAPFAFAPLNPMVSAYPLMGHRVQPYGW 71 >SB_16232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 148 LESIEKRKAISSHQDYQHGRLYRRYH*ALLM 240 + S EKR+++S Q + RL ++YH LLM Sbjct: 311 IASEEKRRSVSEDQKKELSRLLKKYHKKLLM 341 >SB_29473| Best HMM Match : CASP_C (HMM E-Value=6.5) Length = 389 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 509 SCQSNEIIYSSRGSRVIVPR*FINFRHSCHLHVLFELFVDT 387 S QS + I SR + PR +N CH++ FE V+T Sbjct: 315 SNQSRDSIVHSRDHSTVTPRDHLNPEPRCHVNSTFEEEVET 355 >SB_12423| Best HMM Match : Glypican (HMM E-Value=1.00053e-42) Length = 737 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 404 ELFVDTHFQISKYRTGKF*DTAIVFTNFF*NI 309 ++FVD +++KY GK D + V NFF N+ Sbjct: 302 QVFVDLFQELNKYYDGKNMDLSQVMNNFFANL 333 >SB_56560| Best HMM Match : GBP_C (HMM E-Value=0.065) Length = 557 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 277 WSLNTTLISFRVSSVAPNDSADIIVHADSPDVTKWLS 167 W LNT L+SF +S + + S D+ + T+++S Sbjct: 186 WMLNTDLVSFALSELEFSPSIDLFASRLNKQFTRYVS 222 >SB_8982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 432 Score = 27.9 bits (59), Expect = 5.9 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 7/77 (9%) Frame = -3 Query: 454 QGNSLTLDTPVICTSCLNCS*TLIFKSVNIAPES---FKTPPSFSPISFKILKYFLL--- 293 + + LT+ T C+SC C KS+ A S +PP S + +F L Sbjct: 349 EAHRLTVPTVRNCSSCSTCGRLQTLKSIGGAARSTSFLVSPPGLSHKQLLLSSFFSLDPA 408 Query: 292 -KHECGWSLNTTLISFR 245 K EC L +SF+ Sbjct: 409 IKRECLVYLGWLYVSFK 425 >SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) Length = 1769 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 277 WSLNTTLISFRVSSVAPNDSADIIVHADSPDVTKWLS 167 W LNT L+SF +S + + S D+ + T+++S Sbjct: 346 WMLNTDLVSFALSELEFSPSIDLFASRLNKQFTRYVS 382 >SB_38073| Best HMM Match : ABC_tran (HMM E-Value=1.2e-17) Length = 398 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/67 (22%), Positives = 34/67 (50%) Frame = +3 Query: 96 AHTFLKRSLYNFTDELVTRVNRKTESHFVTSGLSAWTIISALSLGATDETLNEINVVLRL 275 A L+R++ DE V+++T+ + S + + L++ T+ +++ V+ L Sbjct: 280 ARALLRRNVILIIDEATAHVDQRTDVLIQKTIRSKFKDCTVLTIAHRLNTIMDMDRVMLL 339 Query: 276 HPHSCFN 296 +P +C N Sbjct: 340 NPCTCLN 346 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 27.9 bits (59), Expect = 5.9 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -3 Query: 346 TPPSFSPISFKILKYFLLKHECGWSLNTTLISFRVSSVAPND-SADIIVHADSPDVTKW 173 TP F+P+ KIL+Y L+K++ + TL + R S+ ND ++++ D W Sbjct: 294 TPEHFTPLVGKILRYLLMKNK---GIPQTL-ALRHGSILNNDIGCVLMMNGDCQVARNW 348 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,576,085 Number of Sequences: 59808 Number of extensions: 296241 Number of successful extensions: 806 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -