BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H11 (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14070.1 68417.m02172 AMP-binding protein, putative similar t... 29 1.6 At1g11410.1 68414.m01311 S-locus protein kinase, putative simila... 29 2.1 At4g08390.2 68417.m01386 L-ascorbate peroxidase, stromal (sAPX) ... 28 3.7 At4g08390.1 68417.m01385 L-ascorbate peroxidase, stromal (sAPX) ... 28 3.7 At4g35560.1 68417.m05053 expressed protein 28 4.9 At4g00760.1 68417.m00106 two-component responsive regulator fami... 28 4.9 At3g22760.1 68416.m02870 CXC domain containing TSO1-like protein... 27 6.4 At1g77490.1 68414.m09024 L-ascorbate peroxidase, thylakoid-bound... 27 6.4 At3g52820.1 68416.m05820 purple acid phosphatase (PAP22) identic... 27 8.5 >At4g14070.1 68417.m02172 AMP-binding protein, putative similar to AMP-binding protein [gi:1617272] from Brassica napus; contains Pfam AMP-binding enzyme domain PF00501; identical to cDNA acyl-CoA synthetase-like protein GI:20799730 Length = 727 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 475 AVAVLLSQGNSLTLDTPVICTSCLNCS 395 A+ V+L G LT +PV+C L+C+ Sbjct: 487 AIGVILQNGYGLTETSPVVCARTLSCN 513 >At1g11410.1 68414.m01311 S-locus protein kinase, putative similar to receptor-like protein kinase [Arabidopsis thaliana] gi|4008008|gb|AAC95352; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 840 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = -3 Query: 391 TLIFKSVNIAPESFKTPPSFSPISFKILKYFLLKHECGWSLNTTLISFRVSSVA 230 +L+FK K P SF+P SF + F+L+ S + L F +S++A Sbjct: 459 SLLFKEAKTTNTLRKAPSSFAPSSFDLEDSFILEELEDKSRSRELPLFELSTIA 512 >At4g08390.2 68417.m01386 L-ascorbate peroxidase, stromal (sAPX) identical to stromal ascorbate peroxidase [Arabidopsis thaliana] gi|1419388|emb|CAA67425 Length = 372 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 291 FNRKYFNILKEIGENDGGVLKLSGAIFTDLKMSVY-EQFKQD 413 F+ YF +KE + D VL AIF D VY E++ D Sbjct: 301 FDNSYFKEIKEKRDEDLLVLPTDAAIFEDSSFKVYAEKYAAD 342 >At4g08390.1 68417.m01385 L-ascorbate peroxidase, stromal (sAPX) identical to stromal ascorbate peroxidase [Arabidopsis thaliana] gi|1419388|emb|CAA67425 Length = 372 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 291 FNRKYFNILKEIGENDGGVLKLSGAIFTDLKMSVY-EQFKQD 413 F+ YF +KE + D VL AIF D VY E++ D Sbjct: 301 FDNSYFKEIKEKRDEDLLVLPTDAAIFEDSSFKVYAEKYAAD 342 >At4g35560.1 68417.m05053 expressed protein Length = 917 Score = 27.9 bits (59), Expect = 4.9 Identities = 16/63 (25%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +3 Query: 339 GGVLKLSGAIFTDLKMSVYEQFKQDVQ-MTGVSKVNELPWDNNTATATAINDFVRLATHE 515 G V K TD + E K+ ++ ++ + PW+NN + IN R+ E Sbjct: 719 GSVFKTKSKRTTDTEP---ESSKETIEELSKIFSTANFPWNNNVENSREINTITRVEDEE 775 Query: 516 AID 524 +D Sbjct: 776 ELD 778 >At4g00760.1 68417.m00106 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 367 Score = 27.9 bits (59), Expect = 4.9 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +3 Query: 351 KLSGAIFTDLKMSVYEQFKQDVQMTGVSK-VNELPWDNNTATATAINDFVRLATHEAIDE 527 K S F DL SV + + ++ G S +E+P ++ + +++ THEA+DE Sbjct: 268 KWSAESFIDLTASVENESQDPLESVGDSVGPHEIPLSPPESSNNNVAAQLQMPTHEALDE 327 Query: 528 IVTPSDL 548 V L Sbjct: 328 EVMQDGL 334 >At3g22760.1 68416.m02870 CXC domain containing TSO1-like protein 1 (SOL1) identical to CXC domain containing TSO1-like protein 1 (SOL1) [Arabidopsis thaliana] GI:7767427; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain; supporting cDNA gi|7767426|gb|AF205142.1|AF205142 Length = 609 Score = 27.5 bits (58), Expect = 6.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 271 LNTTLISFRVSSVAPNDSADIIVHADSPDVTKW 173 ++ LI +++++PN + H DSP+ T W Sbjct: 554 MSENLIHSPITTLSPNSKRVSLSHLDSPESTPW 586 >At1g77490.1 68414.m09024 L-ascorbate peroxidase, thylakoid-bound (tAPX) identical to thylakoid-bound ascorbate peroxidase GB:CAA67426 [Arabidopsis thaliana] Length = 426 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 291 FNRKYFNILKEIGENDGGVLKLSGAIFTDLKMSVY-EQFKQDV 416 F+ YF +KE ++D VL A+F D Y E++ +DV Sbjct: 280 FDNSYFKDIKEKRDDDLLVLPTDAALFEDPSFKNYAEKYAEDV 322 >At3g52820.1 68416.m05820 purple acid phosphatase (PAP22) identical to purple acid phosphatase (PAP22)GI:20257494 from [Arabidopsis thaliana] Length = 434 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 406 LNCS*TLIFKSVNIAPE-SFKTPPSFSPISFKIL 308 L + T ++ PE SFKTPPS P+ F I+ Sbjct: 113 LQANTTYYYRCGGNGPEFSFKTPPSTFPVEFAIV 146 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,795,760 Number of Sequences: 28952 Number of extensions: 207247 Number of successful extensions: 545 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -