BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_H04 (357 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0187 + 41862342-41862622,41862730-41862912,41863236-418632... 27 5.7 >01_07_0187 + 41862342-41862622,41862730-41862912,41863236-41863299, 41863547-41863756,41863850-41864035,41864180-41864478, 41864584-41864731,41864798-41864863,41864945-41865217, 41865523-41865741,41865864-41866013 Length = 692 Score = 26.6 bits (56), Expect = 5.7 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +2 Query: 110 CLISGEILTPPPFLKKNYVTFVPGKK----TFIIRNNISGFSFEILYF 241 C + GE T P + V + T+I+ + +SGFS E+L F Sbjct: 455 CNMIGESFTHPKDIPSRLARAVSAQSDFFITYILTDGMSGFSLEVLQF 502 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,010,995 Number of Sequences: 37544 Number of extensions: 114589 Number of successful extensions: 165 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 542368620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -